Polypeptide MELO3C024575P1
Accession: MELO3C024575P1
Name: MELO3C024575P1
Description: Similar to UPF0554 protein C2orf43 homolog (Rattus norvegicus PE=2 SV=1) (uniprot_sprot:sp|Q5HZX7|CB043_RAT)
Sequence:
>MELO3C024575P1 Similar to UPF0554 protein C2orf43 homolog (Rattus norvegicus PE=2 SV=1) (uniprot_sprot:sp|Q5HZX7|CB043_RAT) MFLQLPSLTVRPTVLISYSYSRLKNFSRCSFLHMGHQVLQSFSKRRVEFRLCNVSGFTNELLEIHSDDPSLHVLFIPGNP GIISFYKDFVESLYQLLGGHVSITAIGHICQTKKDWEGGRLFSLQEQIDHKVEFVRQELQNKDIPLILVGHSVGSYISIE LFRRFQDRAVYCIGLHPFMMVNKESRQQFFIEKLARSPLLSTFFFSSFVALLGILPIQASSFVVRKTIGKSWSRTACEAA CSHLLKYHSMRNVLYMAMTEFEKFSETPDWAFMKKVSQKLSFLFCMDDHWAPMHVYEEIFKQVPEIDLSVEREGYSHAFC CSEAASIYIAQYVASLVKKHLSD*
Download fasta sequence.
Properties
These properties come from blast2go analysis
cellular_component: plastid.
These properties come from phylome analysis
molecular_function: protein binding.
cellular_component: integral to membrane, lipid particle, cytoplasm.
This polypeptide in other databases
In PhylomeDB is Phy003AC7Y_CUCME .

