Polypeptide MELO3C024596P1
Accession: MELO3C024596P1
Name: MELO3C024596P1
Description: Similar to DNA polymerase delta catalytic subunit (Oryza sativa subsp. japonica) (uniprot_sprot:sp|Q9LRE6|DPOD1_ORYSJ)
Sequence:
>MELO3C024596P1 Similar to DNA polymerase delta catalytic subunit (Oryza sativa subsp. japonica) (uniprot_sprot:sp|Q9LRE6|DPOD1_ORYSJ) MTLNSCSPIAGVDVLSFDTERDVLLAWRDLIREVDPDIIIGYNICKFDLPYLIERAEALKIPEFPLLGRIRNSKVRVKDT TFSSRQLGTRESKEITVEGRVQFDLLQAMQRDYKLSSYSLNSVSSHFLSEQKEDVHHSIISDLQNGNAETRRRLAVYCLK DAYLPQRLLDKLMFIYNYVEMARVTGVPISFLLSRGQSIKVLSQLLRKAKQKNLVIPNAKHAGSDQGTYEGATVLEARAG FYEKPIATLDFASLYPSIMMAYNLCYCTLVTPEDARKLNLPPEHFNKTPSGEIFVKPNLQKGILPEILEELLTARKRAKA DLKEAKDPFEKAVLDGRQLALKISANSVYGFTGATVGQLPCLEISSSVTSYGRQMIEHTKKLVEDKFTTLGGYEHNAEVI YGDTDSVMVQFGVPSVEAAMVLGREAAEYISGTFIKPIKLEFEKVYYPYLLISKKRYAGLFWTNPNKFDKMDTKGIETVR RDNCLLVKNLVNECLHKILIDRDVPGAVQYVKNTISDLLMNRVDLSLLVITKGLTKTGDDYEVKAAHVELAERMRKRDAA TAPNVGDRVPYVIIKAAKGAKAYERSEDPIYVLENSIPIDPQYYLENQISKPLLRIFEPILKNASKELLHGSHTRSIFIS TPSNGGIMKFAKKQLTCIGCKALLG*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: zinc ion binding, exonuclease activity, DNA-directed DNA polymerase activity, DNA binding, nucleotide binding.
cellular_component: nucleus.
biological_process: DNA replication.
These properties come from reactome analysis
REACTOME_REACTION: RPA binds to the Flap (REACT_2026), Removal of remaining Flap (REACT_2024), Cleavage of flap structures (REACT_81149), Formation of C-strand Okazaki fragments (REACT_8029), Recruitment of Dna2 endonuclease (REACT_79480), Removal of remaining Flap from the C-strand (REACT_29736), Formation of Okazaki fragments (REACT_104153), POL delta associates with AP site displacing POL Beta (REACT_2121), Formation of Okazaki fragments (REACT_109069), Formation of Processive Complex (REACT_82155), RPA binds to the Flap on the C-strand (REACT_7949), Removal of remaining Flap from the C-strand (REACT_97146), Recruitment of Dna2 endonuclease to the C strand (REACT_30357), Formation of Processive Complex (REACT_1009), Repair synthesis of patch ~27-30 bases long by DNA Pol Delta (REACT_465), Formation of the Flap Intermediate on the C-strand (REACT_28735), Formation of the Flap Intermediate (REACT_1572), Formation of the Flap Intermediate (REACT_33401), Ligation of DNA at sites of patch replacement (REACT_1247), Formation of Okazaki fragments (REACT_1024), Formation of the Flap Intermediate on the C-strand (REACT_97574), DNA strand displacement synthesis (REACT_102164), Recruitment of Dna2 endonuclease (REACT_103547), Joining of adjacent Okazaki fragments of the C-strand (REACT_7994), Formation of Processive Complex on the C-strand of the telomere (REACT_77820), Formation of Processive Complex on the C-strand of the telomere (REACT_108058), Recruitment of Dna2 endonuclease to the C strand (REACT_79008), Formation of the Flap Intermediate (REACT_78319), Disassociation of Processive Complex and Completed Telomere End (REACT_86194), Removal of remaining Flap (REACT_79626), Formation of C-strand Okazaki fragments (REACT_77128), Cleavage of flap structures (REACT_80191), Removal of RNA primer and dissociation of RPA and Dna2 from the C-strand (REACT_7955), Disassociation of Processive Complex and Completed Telomere End (REACT_7954), Formation of Processive Complex on the C-strand of the telomere (REACT_7979), Formation of Processive Complex (REACT_87660), Joining of adjacent Okazaki fragments of the C-strand (REACT_94317), Formation of the Flap Intermediate on the C-strand (REACT_7973), Repair synthesis for gap-filling by DNA pol delta in TC-NER (REACT_1196), Ligation of DNA at sites of patch replacement (REACT_87237), Joining of adjacent Okazaki fragments of the C-strand (REACT_106919), Removal of remaining Flap from the C-strand (REACT_7975), Cleavage of flap structures (REACT_2189), Removal of remaining Flap (REACT_96177), Removal of RNA primer and dissociation of RPA and Dna2 (REACT_315), Formation of C-strand Okazaki fragments (REACT_93535), Recruitment of Dna2 endonuclease (REACT_1278), Ligation of DNA at sites of patch replacement (REACT_98339), DNA strand displacement synthesis (REACT_81625), Recruitment of Dna2 endonuclease to the C strand (REACT_8015), DNA strand displacement synthesis (REACT_41), Disassociation of Processive Complex and Completed Telomere End (REACT_85317).
biological_process: DNA strand elongation involved in DNA replication, nucleotide-excision repair, DNA repair, mitotic cell cycle, base-excision repair, telomere maintenance, telomere maintenance via semi-conservative replication, nucleotide-excision repair, DNA gap filling, transcription-coupled nucleotide-excision repair, telomere maintenance via recombination, S phase of mitotic cell cycle.
REACTOME_COMPLEX: Processive complex [nucleoplasm] (REACT_3120), Processive complex loaded on telomere:Okazaki fragment:Flap:RPA heterotrimer [nucleoplasm] (REACT_8468), Processive complex:Okazaki fragments:Remaining Flap [nucleoplasm] (REACT_4338), Processive complex:nicked DNA from adjacent Okazaki fragments [nucleoplasm] (REACT_4371), Ligated patch-repaired DNA [nucleoplasm] (REACT_5348), Processive complex loaded on telomere [nucleoplasm] (REACT_8041), Processive complex loaded on telomere:Okazaki fragments:Remaining Flap [nucleoplasm] (REACT_8363), Processive complex:Okazaki fragment:Flap:RPA heterotrimer [nucleoplasm] (REACT_4699), Processive complex loaded on telomere:Okazaki fragment complex [nucleoplasm] (REACT_8837), Processive complex loaded on telomere:Okazaki fragment:Flap:RPA heterotrimer:dna2 [nucleoplasm] (REACT_8321), single-stranded DNA flap structure at the site of damaged residue [nucleoplasm] (REACT_2352), DNA Polymerase delta tetramer [nucleoplasm] (REACT_5801), POL Delta:APE1-bound 5 incised DNA strand break containing first resynthesized nucleotide [nucleoplasm] (REACT_3786), Processive complex:Okazaki fragment:Flap [nucleoplasm] (REACT_4984), Processive complex:Okazaki fragment complex [nucleoplasm] (REACT_5537), DNA containing unligated replacement-synthesized patch [nucleoplasm] (REACT_3364), Processive complex loaded on telomere:nicked DNA from adjacent Okazaki fragments [nucleoplasm] (REACT_8309), Processive complex loaded on telomere:ligated C-strand Okazaki fragments [nucleoplasm] (REACT_8541), Processive complex loaded on telomere:Okazaki fragment:Flap [nucleoplasm] (REACT_8956), Processive complex:Okazaki fragment:Flap:RPA heterotrimer:dna2 [nucleoplasm] (REACT_3597).
REACTOME_PATHWAY: Synthesis of DNA (REACT_29939), Polymerase switching on the C-strand of the telomere (REACT_101756), Chromosome Maintenance (REACT_22172), Repair synthesis for gap-filling by DNA polymerase in TC-NER (REACT_1993), Chromosome Maintenance (REACT_105513), Processive synthesis on the C-strand of the telomere (REACT_8027), DNA Repair (REACT_107446), Processive synthesis on the C-strand of the telomere (REACT_82465), Nucleotide Excision Repair (REACT_1826), Leading Strand Synthesis (REACT_81940), Gap-filling DNA repair synthesis and ligation in GG-NER (REACT_1998), Removal of the Flap Intermediate (REACT_106604), Base Excision Repair (REACT_99288), S Phase (REACT_82813), Telomere C-strand (Lagging Strand) Synthesis (REACT_7961), Resolution of Abasic Sites (AP sites) (REACT_100019), Removal of DNA patch containing abasic residue (REACT_28914), Base Excision Repair (REACT_1104), Removal of the Flap Intermediate from the C-strand (REACT_7999), Telomere Maintenance (REACT_7970), Cell Cycle, Mitotic (REACT_152), Global Genomic NER (GG-NER) (REACT_2253), Resolution of AP sites via the multiple-nucleotide patch replacement pathway (REACT_94766), Telomere C-strand (Lagging Strand) Synthesis (REACT_103769), Removal of the Flap Intermediate (REACT_70), DNA Repair (REACT_82907), Removal of the Flap Intermediate from the C-strand (REACT_87982), Gap-filling DNA repair synthesis and ligation in TC-NER (REACT_74), Leading Strand Synthesis (REACT_86413), Chromosome Maintenance (REACT_94825), Telomere C-strand (Lagging Strand) Synthesis (REACT_91367), Cell Cycle, Mitotic (REACT_85950), Polymerase switching (REACT_31697), Leading Strand Synthesis (REACT_1838), Extension of Telomeres (REACT_8030), Extension of Telomeres (REACT_79922), Lagging Strand Synthesis (REACT_107883), Polymerase switching on the C-strand of the telomere (REACT_95355), Processive synthesis on the lagging strand (REACT_80193), Extension of Telomeres (REACT_106742), Resolution of Abasic Sites (AP sites) (REACT_108165), Base Excision Repair (REACT_28342), Synthesis of DNA (REACT_2014), Resolution of AP sites via the multiple-nucleotide patch replacement pathway (REACT_104846), DNA strand elongation (REACT_85667), Removal of the Flap Intermediate (REACT_95112), Resolution of AP sites via the multiple-nucleotide patch replacement pathway (REACT_1128), Resolution of Abasic Sites (AP sites) (REACT_1893), S Phase (REACT_34043), Processive synthesis on the lagging strand (REACT_1385), Removal of DNA patch containing abasic residue (REACT_2192), Transcription-coupled NER (TC-NER) (REACT_1628), DNA Replication (REACT_383), Lagging Strand Synthesis (REACT_312), DNA Replication (REACT_85544), Removal of the Flap Intermediate from the C-strand (REACT_102881), S Phase (REACT_899), DNA Replication (REACT_102375), Processive synthesis on the C-strand of the telomere (REACT_108285), Repair synthesis of patch ~27-30 bases long by DNA polymerase (REACT_378), Cell Cycle, Mitotic (REACT_90846), DNA Repair (REACT_216), Telomere Maintenance (REACT_85782), Lagging Strand Synthesis (REACT_86713), Polymerase switching (REACT_1792), Polymerase switching on the C-strand of the telomere (REACT_7987), Polymerase switching (REACT_94517), Synthesis of DNA (REACT_98237), Removal of DNA patch containing abasic residue (REACT_107721), DNA strand elongation (REACT_932), DNA strand elongation (REACT_84115), Telomere Maintenance (REACT_94707), Processive synthesis on the lagging strand (REACT_79693).
These properties come from phylome analysis
molecular_function: metal ion binding, 3'-5'-exodeoxyribonuclease activity, protein binding, chromatin binding, exonuclease activity, DNA-directed DNA polymerase activity, DNA binding, nucleotide binding.
cellular_component: delta DNA polymerase complex, microtubule associated complex, nucleoplasm, nucleotide-excision repair complex, nucleus.
biological_process: DNA replication proofreading, DNA replication, removal of RNA primer, hatching, telomere maintenance via semi-conservative replication, embryo development ending in birth or egg hatching, response to UV, regulation of mitotic cell cycle, response to DNA damage stimulus, receptor-mediated endocytosis, nucleotide-excision repair, DNA gap filling, base-excision repair, gap-filling, transcription-coupled nucleotide-excision repair, nematode larval development, cytokinesis, DNA synthesis involved in DNA repair, telomere maintenance via recombination, S phase of mitotic cell cycle, DNA replication.
These properties come from kegg analysis
KEGG_REACTION: deoxythymidine (R00378), Deoxycytidine (R00377), Deoxyguanosine (R00376), Deoxyadenosine (R00375).
KEGG_ORTHOLOGS: DNA polymerase delta subunit 1 [EC:2.7.7.7] (K02327).
molecular_function: DNA-directed DNA polymerase activity.
COG: DNA polymerase elongation subunit (family B) (COG0417).
This polypeptide in other databases
In PhylomeDB is Phy003MIPT_CUCME .
