Polypeptide MELO3C024690P1
Accession: MELO3C024690P1
Name: MELO3C024690P1
Description: Similar to Rac-like GTP-binding protein ARAC7 (Arabidopsis thaliana) (uniprot_sprot:sp|O82480|RAC7_ARATH)
Sequence:
>MELO3C024690P1 Similar to Rac-like GTP-binding protein ARAC7 (Arabidopsis thaliana) (uniprot_sprot:sp|O82480|RAC7_ARATH) MELLGKLVCSSVTPVTSFLLIIFLQFLITSVLMWLWMGILSTWDYGTLLVKRKDYSRLRPLSYRGADVFVVAFSLISKAS YENVLKKWMPELRRFAPSVPIVLVGTKLDLRDNGAYFTDHAGSNTITYSQGEELRKQIGAAAYIECSSKTQQNVKAVFDT AIKVVLQPPRRIEMPRKRRNRRSGCSIVRCIACGGCTV*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: Activation of Rac1 by pVav1 (REACT_19243), Activation of Rho by LARG and PDZ-RhoGEF (REACT_19137), Rho GTPase:GTP activates downstream effectors (REACT_10126), Inactivation of Rac1 (REACT_19359), Nef binds a ternary complex comprising DOCK2 guanine nucleotide exchange factor for small Rho-family GTPase Rac, its cofactor ELMO1, and Rac, and activates Rac through this interaction (REACT_11090), Recruitment of ABLIM to the plasma membrane (REACT_105221), GAPs inactivate Rho GTPase:GTP by hydrolysis (REACT_9982), GDIs block activation of Rho GTPase:GDP (REACT_104708), VAV3 is a GEF for Rho/Rac family kinases (REACT_31493), p75NTR indirectly activates RAC and Cdc42 via a guanyl-nucleotide exchange factor (REACT_30730), GDIs block activation of Rho GTPase:GDP (REACT_90207), p115-RhoGEF activation of Rac1 (REACT_33674), Activation of PAK by Rac1 (REACT_19269), Phosphorylation of LIMK-1 by PAK (REACT_19221), Activation of PAK by Rac1 and Cdc42 (REACT_19246), Activation of Rac1 (REACT_22200), VAV3 is a GEF for Rho/Rac family kinases (REACT_23936), VAV1 is a GEF for Rho/Rac family kinases (REACT_85754), Activation of PAK by Rac1 and Cdc42 (REACT_102281), Dissociation of Rho GTP:GDP from GDI complex (REACT_107777), Rac1 binds PlexinA (REACT_19160), Inactivation of R-Ras by Sema3A-Plexin-A GAP activity (REACT_19117), GEFs activate Rho GTPase:GDP (REACT_92645), LARG and PDZ-RhoGEF binds to Plexin-B1 (REACT_19153), Active Rac1 interacts with Plexin-B1:Sema4D (REACT_19354), Activation of Rac1 by FARP2 (REACT_98250), Recruitment of Rnd1 to Plexin A (REACT_19337), Dissociation of Rho GTP:GDP from GDI complex (REACT_10051), Rac1 activation of PI3K (REACT_754), GDIs block activation of Rho GTPase:GDP (REACT_10055), Activation of Rac by Sos (REACT_19386), Activation of Rac1 by FARP2 (REACT_19363), p75NTR indirectly activates RAC and Cdc42 via a guanyl-nucleotide exchange factor (REACT_95747), p75NTR indirectly activates RAC and Cdc42 via a guanyl-nucleotide exchange factor (REACT_13694), Recruitment of ABLIM to the plasma membrane (REACT_22398), Dissociation of Rho GTP:GDP from GDI complex (REACT_96768), VAV1 is a GEF for Rho/Rac family kinases (REACT_24016), GAPs inactivate Rho GTPase:GTP by hydrolysis (REACT_30412), Inactivation of Rac1 (REACT_19409), GEFs activate Rho GTPase:GDP (REACT_77531), Activation of JNK by DSCAM (REACT_25384), Activation of Rac by Sos (REACT_19252), DSCAM associates with Rac1-GTP:pPAK1 (REACT_24940), GAPs inactivate Rho GTPase:GTP by hydrolysis (REACT_29594), Activation of Rac1 (REACT_96171), Activation of Rac1 by VAV2 (REACT_22180), Autophosphorylation of PAK (REACT_19197), VAV2 is a GEF for Rho/Rac family kinases (REACT_23806), DOCKs bind to RhoGEFs (REACT_25140), GEFs activate Rho GTPase:GDP (REACT_10098), p115-RhoGEF activation of Rac1 (REACT_1214), DSCAM associates with Rac1-GTP:pPAK1 (REACT_105228), Interaction of PAK1 with Rac1-GTP (REACT_22371).
REACTOME_PATHWAY: CD28 dependent Vav1 pathway (REACT_109314), SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion (REACT_105487), Axon guidance (REACT_110262), Activation of Rac (REACT_19226), NRAGE signals death through JNK (REACT_30763), Activation of Rac (REACT_31476), NRAGE signals death through JNK (REACT_13638), Signaling by Rho GTPases (REACT_91397), p75 NTR receptor-mediated signalling (REACT_93200), Host Interactions of HIV factors (REACT_6288), Hemostasis (REACT_92318), Signaling by Rho GTPases (REACT_103736), Inactivation of Cdc42 and Rac (REACT_87930), Sema3A PAK dependent Axon repulsion (REACT_19236), Signaling by Rho GTPases (REACT_11044), CD28 dependent Vav1 pathway (REACT_19238), Netrin-1 signaling (REACT_22237), NRAGE signals death through JNK (REACT_77132), Cell death signalling via NRAGE, NRIF and NADE (REACT_13720), Hemostasis (REACT_604), Factors involved in megakaryocyte development and platelet production (REACT_24970), GPCR downstream signaling (REACT_81307), Rho GTPase cycle (REACT_11051), Signaling by Robo receptor (REACT_19351), Costimulation by the CD28 family (REACT_34799), Immune System (REACT_6900), Rho GTPase cycle (REACT_88001), HIV Infection (REACT_6185), Nef and signal transduction (REACT_11068), GPVI-mediated activation cascade (REACT_1695), Axon guidance (REACT_18266), Platelet activation triggers (REACT_622), Inactivation of Cdc42 and Rac (REACT_19342), Costimulation by the CD28 family (REACT_19344), Adaptive Immunity Signaling (REACT_103669), Sema4D mediated inhibition of cell attachment and migration (REACT_19266), Signaling by GPCR (REACT_81368), GPCR downstream signaling (REACT_19184), Signalling by NGF (REACT_90112), CD28 co-stimulation (REACT_19183), Interactions of the immunoglobulin superfamily (IgSF) member proteins (REACT_31025), Cell death signalling via NRAGE, NRIF and NADE (REACT_104880), Interactions of the immunoglobulin superfamily (IgSF) member proteins (REACT_23853), Signal transduction by L1 (REACT_22272), G alpha (12/13) signalling events (REACT_107383), Adaptive Immunity Signaling (REACT_75774), p75 NTR receptor-mediated signalling (REACT_77946), p75 NTR receptor-mediated signalling (REACT_13776), Signalling by NGF (REACT_97378), Platelet activation triggers (REACT_78872), Sema4D induced cell migration and growth-cone collapse (REACT_19277), Semaphorin interactions (REACT_19271), SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion (REACT_19279), Platelet Activation (REACT_88667), Rho GTPase cycle (REACT_82220), Immune System (REACT_105951), Cell death signalling via NRAGE, NRIF and NADE (REACT_106417), Formation of Platelet plug (REACT_20), Formation of Platelet plug (REACT_104262), Signaling by Robo receptor (REACT_103969), Signaling by GPCR (REACT_14797), CD28 co-stimulation (REACT_30546), DCC mediated attractive signaling (REACT_98150), Semaphorin interactions (REACT_93257), DSCAM interactions (REACT_25299), Netrin-1 signaling (REACT_110025), G alpha (12/13) signalling events (REACT_18407), The role of Nef in HIV-1 replication and disease pathogenesis (REACT_6835), L1CAM interactions (REACT_22205), GPVI-mediated activation cascade (REACT_33635), DCC mediated attractive signaling (REACT_22351), Platelet Activation (REACT_798), Signalling by NGF (REACT_11061), Sema4D in semaphorin signaling (REACT_19259), DSCAM interactions (REACT_34513).
REACTOME_COMPLEX: RAC1-GDP [cytosol] (REACT_22018), pPAK(S144):Rac1-GTP [cytosol] (REACT_26868), RhoGTPase:GTP:Effectors complex [plasma membrane] (REACT_10149), PAK bound to Rac1 and Cdc42 [cytosol] (REACT_19943), Rac1:GTP [cytosol] (REACT_20358), Sema3A:Nrp-1:pPlexinA:Fyn:Fes:Rac-1-GTP:Rnd1 [plasma membrane] (REACT_19802), Active Rac1 bound to Netrin-1-DCC complex [plasma membrane] (REACT_22845), Rac1:GDP [cytosol] (REACT_20102), Sema3A:Nrp-1:pPlexinA:Fyn:Fes:Rac-1-GTP [plasma membrane] (REACT_20187), RAC1-GTP [cytosol] (REACT_21594), Vav2 Rho/Rac effectors:GTP [cytosol] (REACT_24831), Sema4D:pPlexin-B1:ErbB2:Rac1:Rnd1 [plasma membrane] (REACT_19890), Sema4D:pPlexin-B1:Met:RAC1-GTP [plasma membrane] (REACT_20028), DSCAM:pPAK(S144):Rac1-GTP [plasma membrane] (REACT_26061), RhoGTPase:GDP [cytosol] (REACT_10889), Vav3 Rho/Rac effectors:GDP [cytosol] (REACT_24607), Inactivated RhoGTPase:GDP:GDI complex [cytosol] (REACT_10882), Activated Rac1:PI3K alpha [cytosol] (REACT_5860), Vav3 Rho/Rac effectors:GTP [cytosol] (REACT_24491), pPAK1:Rac1-GTP [cytosol] (REACT_23376), Vav1 Rho/Rac effectors:GTP [cytosol] (REACT_4042), RAC:GDP [plasma membrane] (REACT_14026), Vav2 Rho/Rac effectors:GDP [cytosol] (REACT_24745), RhoGTPase:GDP [plasma membrane] (REACT_10155), Sema4D:Plexin-B1:Rac-Rnd1:LARG/PDZ-RhoGEF [plasma membrane] (REACT_20349), RAC:GTP [plasma membrane] (REACT_14200), Sema3A:Nrp-1:PlexinA:Rac1-GTP:PAK [plasma membrane] (REACT_20083), Vav1 Rho/Rac effectors:GDP [cytosol] (REACT_4113), DOCK2:ELMO1:RAC1:Nef Complex [cytosol] (REACT_11827), RhoGTPase:GTP [plasma membrane] (REACT_10731), Netrin-1:DCC:pFyn:Nck:Rac1-GTP:Ablim [plasma membrane] (REACT_23105), DOCK-GEFs:RAC1, CDC42 [cytosol] (REACT_25414), Sema3A:Nrp-1:PlexinA:Rac1-GTP:pPAK [plasma membrane] (REACT_19495).
biological_process: viral reproduction, regulation of defense response to virus by virus, apoptosis, induction of apoptosis by extracellular signals, axon guidance, nerve growth factor receptor signaling pathway, regulation of small GTPase mediated signal transduction, T cell costimulation, platelet activation, blood coagulation, small GTPase mediated signal transduction.
These properties come from blast2go analysis
molecular_function: GTP binding, sphingomyelin phosphodiesterase activity.
cellular_component: membrane, intracellular.
biological_process: protein transport, small GTPase mediated signal transduction.
This polypeptide in other databases
In PhylomeDB is Phy0039ZVH_CUCME .
