Polypeptide MELO3C025005P1

Accession: MELO3C025005P1

Name: MELO3C025005P1

Description: Similar to ATP synthase delta chain, chloroplastic (Nicotiana tabacum) (uniprot_sprot:sp|P32980|ATPD_TOBAC)

Sequence:

>MELO3C025005P1 Similar to ATP synthase delta chain, chloroplastic (Nicotiana tabacum) (uniprot_sprot:sp|P32980|ATPD_TOBAC)
MAALHQTAASLQAKLLPTARISRTTPVNLSFSATFPSRGLRLGQHRSHGGARMSATAAGSYAAALAEVAASNNTLDATSS
DVEKIESVFADPQVLDFFSNPTISVEKKQAVVDEIASSSSLQPHSANFLKILVDAKRIDILKEIVTEFELVYNKITNTEL
AVVSSVVQLEQQHLAQIAKQVQKLSGAKNVRIKTQIDPSLVAGFTVRFGNSGSKLIDLSVKKQLEEIAAQLDLGNIQLAV
*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: hydrogen ion transporting ATP synthase activity, rotational mechanism.

cellular_component: proton-transporting ATP synthase complex, catalytic core F(1), chloroplast envelope, chloroplast thylakoid membrane, plasma membrane, mitochondrion.

biological_process: defense response to bacterium, ATP synthesis coupled proton transport.

These properties come from reactome analysis


REACTOME_REACTION: ADP and Pi bind to ATPase (REACT_991), ATP is synthesized from ADP and Pi by ATPase (REACT_190), Enzyme-bound ATP is released (REACT_1985).

REACTOME_PATHWAY: Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. (REACT_6305), Formation of ATP by chemiosmotic coupling (REACT_6759).

REACTOME_COMPLEX: ATPase complex [mitochondrial inner membrane] (REACT_4862), ATPase-ATP complex [mitochondrial inner membrane] (REACT_3945), ATPase-ADP and Pi complex [mitochondrial inner membrane] (REACT_2435).

biological_process: respiratory electron transport chain, mitochondrial ATP synthesis coupled proton transport.

These properties come from phylome analysis


molecular_function: hydrogen ion transporting ATP synthase activity, rotational mechanism.

cellular_component: stromule, plastoglobule, proton-transporting ATP synthase complex, catalytic core F(1), chloroplast envelope, chloroplast thylakoid membrane, plasma membrane.

biological_process: photosynthetic electron transport in photosystem I, photosynthetic electron transport in photosystem II, response to cold, defense response to bacterium, ATP synthesis coupled proton transport.

These properties come from kegg analysis


KEGG_ORTHOLOGS: F-type H+-transporting ATPase subunit delta [EC:3.6.3.14] (K02113).

molecular_function: proton-transporting ATPase activity, rotational mechanism, hydrogen ion transporting ATP synthase activity, rotational mechanism.

COG: F0F1-type ATP synthase, delta subunit (mitochondrial oligomycin sensitivity protein) (COG0712).

Locations

Located in CM3.5_scaffold00073 from 721264 to 721986.

This polypeptide in other databases

In PhylomeDB is Phy003A3C2_CUCME .

Related features