Polypeptide MELO3C025022P2

Accession: MELO3C025022P2

Name: MELO3C025022P2

Description: Similar to DNA excision repair protein ERCC-1 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9MA98|ERCC1_ARATH)

Sequence:

>MELO3C025022P2 Similar to DNA excision repair protein ERCC-1 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9MA98|ERCC1_ARATH)
MEEGSAEENFQQTPHKKSKTIIKIPSYQEVFDSSQPKSQSFSQAFAFLKSSEFYSPPPKPPSPSSSQSLPASNITNPRKN
DQLDTSSSSTSASTATPVNSLSVSSSVSRNAILVSNRQKGNPLLKHIRNVRWAFADVVPDYLLGQSSCALYLSLRYHLLH
PDYLYYRIRELQKNFKLRVVLCHVDVEDVVKPLLEVTKTALLHDCTLLCAWSLEECGRYLETIKVYENKPADLIQGQMDT
DYLSRLTHVLTSVRHVNKTDVVTLGTTFGSLSHIMDASMEDLARCPGIGERKVRRLYDTFHEPFKRIVSTHPAVPETPTQ
NSTKPRSINEEQDVDGKRIEEDGSQHKKEPKLNVKSALSAAFAKYADKIAKSSSMPQEKEIGEPESSNVQ*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: 5 incision leading to excision of DNA fragment with lesion in TC-NER (REACT_31162), Displacement of stalled Pol II from the lesion site (REACT_103124), 3- incision of DNA by XPG in GG-NER (REACT_81714), Displacement of stalled Pol II from the lesion site (REACT_1284), Formation of ERCC1-XPF heterodimeric complex (REACT_1438), 5 incision leading to excision of DNA fragment with lesion in TC-NER (REACT_811), Binding of ERCC1-XPF to preincision complex (REACT_101859), Binding of ERCC1-XPF to preincision complex (REACT_2163), Displacement of stalled Pol II from the lesion site (REACT_108076), Formation of ERCC1-XPF heterodimeric complex (REACT_110884), Formation of ERCC1-XPF heterodimeric complex (REACT_104097), Assembly of repair proteins at the site of Pol II blockage (REACT_1584), 3 incision of the lesioned strand of DNA in TC-NER (REACT_1274), 5 incision leading to excision of DNA fragment with lesion in TC-NER (REACT_31823), Binding of ERCC1-XPF to preincision complex (REACT_99635), 3- incision of DNA by XPG in GG-NER (REACT_100654), 3 incision of the lesioned strand of DNA in TC-NER (REACT_92741), 5-incision of DNA by ERCC1-XPF in GG-NER (REACT_1311), 3- incision of DNA by XPG in GG-NER (REACT_1124), 3 incision of the lesioned strand of DNA in TC-NER (REACT_80967).

biological_process: nucleotide-excision repair, transcription-coupled nucleotide-excision repair, DNA repair, nucleotide-excision repair, DNA damage removal.

REACTOME_COMPLEX: ERCC1:XPF complex [nucleoplasm] (REACT_3454), Transcription-coupled (TC) repair complex [nucleoplasm] (REACT_3969), incision complex for GG-NER [nucleoplasm] (REACT_5159), Incision complex with 3-incised damaged DNA [nucleoplasm] (REACT_5099).

REACTOME_PATHWAY: Formation of incision complex in GG-NER (REACT_30166), DNA Repair (REACT_107446), Nucleotide Excision Repair (REACT_77033), Nucleotide Excision Repair (REACT_1826), Transcription-coupled NER (TC-NER) (REACT_96116), Global Genomic NER (GG-NER) (REACT_92144), Transcription-coupled NER (TC-NER) (REACT_93719), Global Genomic NER (GG-NER) (REACT_2253), DNA Repair (REACT_82907), Global Genomic NER (GG-NER) (REACT_103919), Formation of transcription-coupled NER (TC-NER) repair complex (REACT_1941), Formation of incision complex in GG-NER (REACT_82554), Nucleotide Excision Repair (REACT_96106), Formation of incision complex in GG-NER (REACT_257), Transcription-coupled NER (TC-NER) (REACT_1628), Dual incision reaction in TC-NER (REACT_2222), Dual incision reaction in GG-NER (REACT_311), DNA Repair (REACT_216), Dual incision reaction in GG-NER (REACT_102444), Dual incision reaction in TC-NER (REACT_91002), Dual incision reaction in GG-NER (REACT_90961), Dual incision reaction in TC-NER (REACT_109190).

These properties come from phylome analysis


molecular_function: 5'-flap endonuclease activity, endonuclease activity, protein domain specific binding, protein C-terminus binding, single-stranded DNA binding, damaged DNA binding.

cellular_component: cytoplasm, nucleus, nucleoplasm, nuclear chromosome, telomeric region, nucleotide-excision repair complex.

biological_process: response to gamma radiation, response to UV-B, non-photoreactive DNA repair, nucleotide-excision repair, preincision complex assembly, transcription-coupled nucleotide-excision repair, DNA repair, double-strand break repair via homologous recombination, negative regulation of telomere maintenance, response to oxidative stress, mitotic recombination, nucleotide-excision repair, DNA incision, 5'-to lesion, nucleotide-excision repair, DNA incision, 3'-to lesion, nucleotide-excision repair, DNA damage removal.

These properties come from blast2go analysis


molecular_function: protein domain specific binding, protein C-terminus binding, single-stranded DNA binding, damaged DNA binding, single-stranded DNA specific endodeoxyribonuclease activity.

cellular_component: nucleoplasm, nuclear chromosome, telomeric region, nucleotide-excision repair complex.

biological_process: negative regulation of telomere maintenance, response to oxidative stress, mitotic recombination, nucleotide-excision repair, DNA incision, 5'-to lesion, nucleotide-excision repair, DNA incision, 3'-to lesion, nucleotide-excision repair, DNA damage removal.

Locations

Located in CM3.5_scaffold00073 from 1059584 to 1065352.

This polypeptide in other databases

In PhylomeDB is Phy003A3D2_CUCME .

Related features