Polypeptide MELO3C025085P1

Accession: MELO3C025085P1

Name: MELO3C025085P1

Description: Similar to 15.7 kDa heat shock protein, peroxisomal (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FHQ3|HS157_ARATH)

Sequence:

>MELO3C025085P1 Similar to 15.7 kDa heat shock protein, peroxisomal (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FHQ3|HS157_ARATH)
MTNDLFGYPLRRFPWTPASFRQPSGAVALLDWLETSSAHIFKVDVPGFSKDELKVEIEEGNVMHITGNSGEEESVEKEVI
WHLGERQTGKRSFSREIELPENVKLDQIKAQLENGLLTIVVPKDTTPRPSKVKKIKIISKL*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: protein binding.

cellular_component: peroxisomal matrix, mitochondrion.

biological_process: protein oligomerization, response to salt stress, response to heat, protein folding, response to reactive oxygen species.

These properties come from phylome analysis


molecular_function: protein binding.

cellular_component: peroxisome, peroxisomal matrix.

biological_process: response to heat, protein folding, response to reactive oxygen species.

Locations

Located in CM3.5_scaffold00074 from 812461 to 814117.

This polypeptide in other databases

In PhylomeDB is Phy003A72O_CUCME .

Related features