Polypeptide MELO3C025637P1

Accession: MELO3C025637P1

Name: MELO3C025637P1

Description: Similar to Alpha-1,2-mannosyltransferase ALG9 (Mus musculus) (uniprot_sprot:sp|Q8VDI9|ALG9_MOUSE)

Sequence:

>MELO3C025637P1 Similar to Alpha-1,2-mannosyltransferase ALG9 (Mus musculus) (uniprot_sprot:sp|Q8VDI9|ALG9_MOUSE)
MVLTSLYISALSRKFGKRLATYTLAMLCLTSGCFFASTSFLPSSFSMYAVSLSSGLFLLEKPAPAVAVAAAGVILGWPFS
ILVFLPVTLYSLRRKFKEAFLAGALTSIALLAFSLLVDYYYYKRWTSSVLNLLIYNVLGGGESHLYGTEGPLFYLRNGFN
NFNVCFVLALLFVGILPISRKKYVPDLLVVISPIYIWLAFMSLQPHKEERFLYPIYPLICVAASAVIECFPDFFRDRYNP
YDNSVLVVIAKVLRPLVLGLILCASHARTFSLINGYSAPLEVYKVLAHHDEIVTDSTICVGSEWHRFPSSFFFIPDYIKE
VRWIDDGFRGLLPFPFNSTLGGTAAAPPYFNNKNKASDEQYLQDLDACTYLVELQLERPYASRGSDTSKWEAVAAWPYLD
REISPPFYRSFFIPYFWQNKNVFGMYKLLTRITK*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: transferase activity, transferring glycosyl groups.

cellular_component: intrinsic to endoplasmic reticulum membrane.

biological_process: GPI anchor biosynthetic process.

These properties come from reactome analysis


REACTOME_REACTION: Addition of the last mannose to the N-glycan precursor by ALG3, inside the ER lumen. (REACT_22307), Addition of the seventh mannose to the N-glycan precursor by ALG9, inside the ER lumen (REACT_22123).

biological_process: cellular protein metabolic process, post-translational protein modification, protein N-linked glycosylation via asparagine, dolichol-linked oligosaccharide biosynthetic process.

REACTOME_PATHWAY: Post-translational protein modification (REACT_22161), Metabolism of proteins (REACT_17015), Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein (REACT_22433), Asparagine N-linked glycosylation (REACT_22426).

These properties come from phylome analysis


molecular_function: kinase activity, mannosyltransferase activity, alpha-1,2-mannosyltransferase activity, transferase activity, transferring glycosyl groups.

cellular_component: integral to membrane, intrinsic to endoplasmic reticulum membrane.

biological_process: post-translational protein modification, protein N-linked glycosylation via asparagine, dolichol-linked oligosaccharide biosynthetic process, GPI anchor biosynthetic process.

These properties come from kegg analysis


KEGG_REACTION: squalene (R06261), squalene (R06259).

KEGG_ORTHOLOGS: alpha-1,2-mannosyltransferase [EC:2.4.1.259 2.4.1.261] (K03846).

molecular_function: alpha-1,2-mannosyltransferase activity.

Locations

Located in CM3.5_scaffold00081 from 735793 to 739111.

This polypeptide in other databases

In PhylomeDB is Phy003LGDV_CUCME .

Related features