Polypeptide MELO3C025746P2

Accession: MELO3C025746P2

Name: MELO3C025746P2

Description: Similar to Oxidoreductase, putative (Ricinus communis) (uniref90:UniRef90_B9SK30)

Sequence:

>MELO3C025746P2 Similar to Oxidoreductase, putative (Ricinus communis) (uniref90:UniRef90_B9SK30)
MLSSSPFSQFRPIYILQEDRISTFSQNRVIKALQQIFKSPLFTRMLSRGLFSTHISSSLKCFSSSTSNVLKVGDILSYNR
IFTSEDVLEYSKVSHDSNPLHFDPELARRAGFNGCLVHGLLVASMFPHIISSHYPGAIYVSQSLNFKLPVYVGEKIVGQV
EAIELRENKKRYLAKFKTKCLRNGDELVLEGEARAILPAYFHSTNE*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: oxidoreductase activity.

cellular_component: mitochondrion.

biological_process: metabolic process.

These properties come from reactome analysis


REACTOME_REACTION: 3-hydroxypristanoyl-CoA + NAD+ => 3-ketoxypristanoyl-CoA + NADH + H+ (REACT_85352), (24R, 25R) 3alpha,7alpha,12alpha,24-tetrahydroxy-5beta-cholestanoyl-CoA is oxidized to 3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-one-CoA (REACT_84012), trans-2,3-dehydropristanoyl-CoA + H2O => 3-hydroxypristanoyl-CoA (REACT_96877), trans-2,3-dehydrohexacosanoyl-CoA + H2O => 3-hydroxyhexacosanoyl-CoA (REACT_33517), 3-hydroxyhexacosanoyl-CoA + NAD+ => 3-ketohexacosanoyl-CoA + NADH + H+ (REACT_99256), (24R, 25R) 3alpha,7alpha,24-trihydroxy-5beta-cholestanoyl-CoA is oxidized to 3alpha,7alpha-dihydroxy-5beta-cholest-24-one-CoA (REACT_33370), 25(S) 3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA is hydrated to (24R, 25R) 3alpha,7alpha,12alpha,24-tetrahydroxy-5beta-cholestanoyl-CoA (REACT_108955), 25(S) 3alpha,7alpha-dihydroxy-5beta-cholest-24-enoyl-CoA is hydrated to (24R, 25R) 3alpha,7alpha,24-trihydroxy-5beta-cholestanoyl-CoA (REACT_95150).

biological_process: cellular lipid metabolic process, bile acid metabolic process, bile acid biosynthetic process, fatty acid beta-oxidation using acyl-CoA oxidase.

REACTOME_PATHWAY: Synthesis of bile acids and bile salts (REACT_30249), Peroxisomal lipid metabolism (REACT_79191), Bile acid and bile salt metabolism (REACT_94447), Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol (REACT_81858), Metabolism of lipids and lipoproteins (REACT_106721), Beta-oxidation of pristanoyl-CoA (REACT_85427), Beta-oxidation of very long chain fatty acids (REACT_110355).

These properties come from phylome analysis


molecular_function: lyase activity, oxidoreductase activity.

cellular_component: mitochondrion.

biological_process: fatty acid metabolic process.

These properties come from kegg analysis


KEGG_ORTHOLOGS: transcription initiation factor TFIID subunit 9 / adenylate kinase [EC:2.7.4.3] (K14535).

molecular_function: general RNA polymerase II transcription factor activity, adenylate kinase activity.

COG: Predicted nucleotide kinase (related to CMP and AMP kinases) (COG1936).

Locations

Located in CM3.5_scaffold00082 from 892800 to 894500.

This polypeptide in other databases

In PhylomeDB is Phy003A1JU_CUCME .

Related features