Polypeptide MELO3C025755P2
Accession: MELO3C025755P2
Name: MELO3C025755P2
Description: Similar to Proteasome subunit beta type-4 (Arabidopsis thaliana) (uniprot_sprot:sp|Q7DLR9|PSB4_ARATH)
Sequence:
>MELO3C025755P2 Similar to Proteasome subunit beta type-4 (Arabidopsis thaliana) (uniprot_sprot:sp|Q7DLR9|PSB4_ARATH) MSPSDSNQANHGLLCPEAPIQRTQYPYVTGTSVVAIKYKDGILMIADLGGSYGSTLRYKSVERIKAIGKHSLLGASGEIS DFQELLRNLDELILYDNMWDDGNALGPKEIHSYLTRLMYNRRNKFNPLWNSLVLGGVKNGQKYLGTVNMIGVTFEDDHVT TGFGNHLARPILRDEWHENLTFEEGVKLLEKCMRVLLYRDRSAVNKLQIAKITEEGVTISQPYSLKTFWNYSAFENPTSG AEGSW*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: threonine-type endopeptidase activity.
cellular_component: cytosolic ribosome, proteasome core complex, nucleus.
biological_process: response to cadmium ion, response to salt stress, ubiquitin-dependent protein catabolic process.
These properties come from reactome analysis
REACTOME_COMPLEX: 26S proteasome [nucleoplasm] (REACT_7467), 26S proteasome [cytosol] (REACT_2353).
These properties come from phylome analysis
molecular_function: protein binding, threonine-type endopeptidase activity.
cellular_component: intermediate filament cytoskeleton, proteasome storage granule, proteasome core complex, beta-subunit complex, centrosome, endoplasmic reticulum membrane, cytoplasm, cytosolic ribosome, proteasome core complex, nucleus.
biological_process: proteolysis involved in cellular protein catabolic process, positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle, negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle, centrosome organization, interspecies interaction between organisms, proteasome assembly, proteasomal ubiquitin-dependent protein catabolic process, regulation of apoptosis, locomotion, growth, anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process, mRNA metabolic process, viral reproduction, proteasomal ubiquitin-independent protein catabolic process, embryo development ending in birth or egg hatching, determination of adult lifespan, cell proliferation, DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest, response to DNA damage stimulus, apoptosis, regulation of cellular amino acid metabolic process, nematode larval development, M/G1 transition of mitotic cell cycle, S phase of mitotic cell cycle, G1/S transition of mitotic cell cycle, mitotic spindle elongation, reproduction, response to cadmium ion, response to salt stress.
These properties come from kegg analysis
COG: 20S proteasome, alpha and beta subunits (COG0638).
This polypeptide in other databases
In PhylomeDB is Phy003A8LQ_CUCME .
