Polypeptide MELO3C025809P1

Accession: MELO3C025809P1

Name: MELO3C025809P1

Description: Similar to Ubiquitin-like protein ATG12 (Medicago truncatula) (uniprot_sprot:sp|Q1SF86|ATG12_MEDTR)

Sequence:

>MELO3C025809P1 Similar to Ubiquitin-like protein ATG12 (Medicago truncatula) (uniprot_sprot:sp|Q1SF86|ATG12_MEDTR)
MTSTESSTSARKVVVLLRATGDAPILKQTKFKMPGTDKFIKVIDYIRRSIQRDTLFVFVNSAFSPGPDETVIDLYNNFGI
DGKLVVNYACSMAWG*

Download fasta sequence.

Properties

These properties come from blast2go analysis


cellular_component: cytoplasm.

biological_process: modification-dependent protein catabolic process, protein transport, autophagic vacuole assembly.

These properties come from reactome analysis


REACTOME_REACTION: Inhibition of RIG-I/MDA5 signaling by ATG5-ATG12 conjugate (REACT_24982).

biological_process: innate immune response, negative regulation of type I interferon production.

REACTOME_COMPLEX: dsRNA:RIG-I/MDA5:IPS-1:ATG5-ATG12 [mitochondrial outer membrane] (REACT_26782), ATG5-ATG12 conjugate [cytosol] (REACT_26651), IPS-1:ATG5-ATG12 conjugate [mitochondrial outer membrane] (REACT_25931).

REACTOME_PATHWAY: RIG-I/MDA5 mediated induction of IFN-alpha/beta pathways (REACT_25359), Immune System (REACT_6900), Negative regulators of RIG-I/MDA5 signaling (REACT_25271), Innate Immunity Signaling (REACT_6802).

These properties come from phylome analysis


molecular_function: protein tag, protein binding.

cellular_component: Atg12-Atg5-Atg16 complex, pre-autophagosomal structure membrane, membrane fraction, cytoplasm.

biological_process: salivary gland cell autophagic cell death, piecemeal microautophagy of nucleus, negative regulation of type I interferon production, CVT pathway, C-terminal protein lipidation, mitochondrion degradation, protein transport, autophagic vacuole assembly.

These properties come from kegg analysis


KEGG_ORTHOLOGS: autophagy-related protein 12 (K08336).

Locations

Located in CM3.5_scaffold00083 from 527257 to 529994.

This polypeptide in other databases

In PhylomeDB is Phy0039YP3_CUCME .

Related features