Polypeptide MELO3C025869P1
Accession: MELO3C025869P1
Name: MELO3C025869P1
Description: Similar to 50S ribosomal protein L4, chloroplastic (Nicotiana tabacum) (uniprot_sprot:sp|O80361|RK4_TOBAC)
Sequence:
>MELO3C025869P1 Similar to 50S ribosomal protein L4, chloroplastic (Nicotiana tabacum) (uniprot_sprot:sp|O80361|RK4_TOBAC) MAASTSPSSLSFFTSSVFLSSPKHQNPNLFFNCKPNSLKPQTKPLSISSELATLPVLSFTGEKVGETYLDLKSAPPETAR AVVHRAIITDQQNKRRGTASTLTRAEVSGGGKKPYQQKKTGKARRGSMRTPLRPGGGVVFGPKPRDWSIKINRKEKRLAI STAVASAAVNTIVVEEFGDKFEKPKTKEFIAALKRWGIDPKEKSLFLMTEVSDNVRLSSRNIGTLKLLTPRTLNLFDILD SDKLVLTPAAVDYLNERYGINYEEGIEEEEEEEEEEEEEEEEEEEGVEAGEDSDAAE*
Download fasta sequence.
Properties
These properties come from kegg analysis
cellular_component: cytosolic large ribosomal subunit.
COG: Ribosomal protein L4 (COG0088).
These properties come from phylome analysis
molecular_function: poly(U) RNA binding, rRNA binding, structural constituent of ribosome.
cellular_component: ribosome, plastid large ribosomal subunit, cytosolic ribosome, chloroplast stroma, chloroplast thylakoid membrane, nucleus.
biological_process: translation.
These properties come from blast2go analysis
molecular_function: rRNA binding, structural constituent of ribosome.
cellular_component: cytosolic ribosome, chloroplast stroma, chloroplast thylakoid membrane, nucleus.
biological_process: translation, regulation of transcription, DNA-dependent, transcription termination, DNA-dependent.
This polypeptide in other databases
In PhylomeDB is Phy003MHSW_CUCME .

