Polypeptide MELO3C026028P1
Accession: MELO3C026028P1
Name: MELO3C026028P1
Description: Similar to Whole genome shotgun sequence of line PN40024, scaffold_58.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7SR56)
Sequence:
>MELO3C026028P1 Similar to Whole genome shotgun sequence of line PN40024, scaffold_58.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7SR56) MPCLYISTNVNLAGVDSAAIFSATTTAVSSIIGKPENYVMVLLNGSVPISFGGNGDPAVFAEVVSMGGINSEVKRRLIST LGSILNEKLSVPPARFFLKVHDTTAGRPISKL*
Download fasta sequence.
Properties
These properties come from blast2go analysis
cellular_component: membrane.
biological_process: response to other organism, inflammatory response.
These properties come from phylome analysis
cellular_component: peroxisome.
This polypeptide in other databases
In PhylomeDB is Phy003A4K1_CUCME .