Polypeptide MELO3C026158P1
Accession: MELO3C026158P1
Name: MELO3C026158P1
Description: Similar to Ethylene-responsive transcription factor ERF114 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FH54|EF114_ARATH)
Sequence:
>MELO3C026158P1 Similar to Ethylene-responsive transcription factor ERF114 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FH54|EF114_ARATH) MVSALTQVITSGSGSGSGSSRSLSVVEEPAASVRGDNEEGVKRESRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFDTA EAAALAYDEAALRFKGTKAKLNFPERLTTPPSYSYAPYHHQDDHQDHRF*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: sequence-specific DNA binding transcription factor activity.
cellular_component: plastid, nucleolus.
biological_process: defense response to fungus, response to chitin, regulation of transcription, DNA-dependent.
This polypeptide in other databases
In PhylomeDB is Phy003A0ZP_CUCME .

