Polypeptide MELO3C026304P1
Accession: MELO3C026304P1
Name: MELO3C026304P1
Description: Similar to Nuclear cap-binding protein subunit 2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9XFD1|NCBP2_ARATH)
Sequence:
>MELO3C026304P1 Similar to Nuclear cap-binding protein subunit 2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9XFD1|NCBP2_ARATH) MASLFKDPTKLSVYRDRRFHGSQDEFEVALQTSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIIMGLDKNSKTPCGFCFV LYYSREDTEDAVKYISGTILDDRPIRVDFDWGFQDGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDY GTGSLGSMAPVMTQYGKHGGSHGHGHRHGRDYHHRKRYRDDDRHAHESSKRTSDYESRRNSNYESRPEKNPRFRESGDSD EEDDDDRKQRH*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: protein binding, nucleic acid binding, nucleotide binding.
These properties come from reactome analysis
REACTOME_REACTION: Formation of an intermediate Spliceosomal C complex (REACT_625), Formation of DSIF:NELF:HIV-1 early elongation complex (REACT_6357), Hyperphosphorylation (Ser2) of RNA Pol II CTD by P-TEFb complex (REACT_2066), Hyperphosphorylation (Ser2) of RNA Pol II CTD by the P-TEFb(Cyclin T1:Cdk9) complex (REACT_6170), Separation of abortive HIV-1 transcript from template (REACT_6159), Formation of the Spliceosomal A Complex (REACT_788), Docking of Mature Histone mRNA complex:TAP at the NPC (REACT_696), Transport of the export-competent complex through the NPC (REACT_2104), UPF1 Binds an mRNP with a Termination Codon Preceding an Exon Junction Complex (REACT_75753), Cleavage of mRNA at the 3-end (REACT_1914), Lariat Formation and 5-Splice Site Cleavage (REACT_1935), Formation of AT-AC C complex (REACT_1615), Limited elongation of the HIV-1 transcript (REACT_6192), Formation of AT-AC A complex (REACT_864), Formation of the Spliceosomal E complex (REACT_222), Recognition and binding of the mRNA cap by the cap-binding complex (REACT_687), Formation of DSIF:NELF:early elongation complex (REACT_981), Binding of SLBP to Replication-Dependent Histone Pre-mRNA (REACT_706), Formation of the active Spliceosomal C complex (REACT_1554), Cleavage of Intronless Pre-mRNA at 3-end (REACT_460), Abortive termination of early transcription elongation by DSIF:NELF (REACT_989), Release from the NPC and Disassembly of the mRNP (REACT_1228), Recruitment of TAP to the EJC (REACT_53), Hyperphosphorylation (Ser2) of RNA Pol II CTD by P-TEFb complex (REACT_6297), Cleavage of the 3-end of the Histone Pre-mRNA (REACT_1222), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_6250), Cleavage of the 3-end of Replication Dependent Histone Pre-mRNA (REACT_888), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_6206), Formation of cap binding complex (CBC) (REACT_2093), Recruitment of U7 snRNP:ZFP100 complex to the SLBP Bound Pre-mRNA (REACT_967), Formation of UPF1:eRF3 Complex on mRNA with a Premature Termination Codon and No Exon Junction Complex (REACT_75917), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_802), Recognition and binding of the HIV-1 mRNA cap by the cap-binding complex (REACT_6166), ATAC spliceosome mediated 3 splice site cleavage, exon ligation (REACT_1494), mRNA polyadenylation (REACT_1162), Formation of Exon Junction Complex (REACT_774), Formation of pre-mRNPs (REACT_1877), Internal Methylation of mRNA (REACT_1720), Binding of Cleavage factors and Poly(A)Polymerase to the CstF:CPSF:Pre-mRNA Complex (REACT_1724), Docking of the Mature intronless derived transcript derived mRNA, TAP and Aly/Ref at the NPC (REACT_1897), Docking of Mature Replication Dependent Histone mRNA with the NPC (REACT_1604), Docking of the TAP:EJC Complex with the NPC (REACT_138), Recognition of AAUAAA sequence by CPSF (REACT_1652), ATAC spliceosome mediated Lariat formation,5 splice site cleavage (REACT_2241), Recruitment of U7 snRNP:ZFP100 complex to the Histone Pre-mRNA (REACT_1591), Recruitment of CstF to the CPSF Bound Pre-mRNA (REACT_336), SMG1 Phosphorylates UPF1 (Enhanced by Exon Junction Complex) (REACT_75910), Abortive termination of HIV-1 early transcription elongation by DSIF:NELF (REACT_6281), Formation of the Spliceosomal B Complex (REACT_48), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_1251), Nuclear export of snRNA transcripts (REACT_10069), Formation of AT-AC B Complex (REACT_1253), Cleavage and polyadenylation of Intronless Pre-mRNA (REACT_45), Cleavage at the 3-Splice Site and Exon Ligation (REACT_1331).
REACTOME_PATHWAY: Formation of the HIV-1 Early Elongation Complex (REACT_6319), Processing of Intronless Pre-mRNAs (REACT_1096), HIV-1 Transcription Elongation (REACT_6274), Nonsense Mediated Decay Independent of the Exon Junction Complex (REACT_75768), Cleavage of Growing Transcript in the Termination Region (REACT_387), Transcription of the HIV genome (REACT_6233), Nonsense-Mediated Decay (REACT_75886), Transport of Mature mRNA Derived from an Intronless Transcript (REACT_1835), Formation of RNA Pol II elongation complex (REACT_1845), mRNA 3-end processing (REACT_1849), Nonsense Mediated Decay Enhanced by the Exon Junction Complex (REACT_75822), mRNA Processing (REACT_1675), mRNA Splicing (REACT_1735), mRNA Capping (REACT_1470), Transcription (REACT_1788), Transport of the SLBP independent Mature mRNA (REACT_424), Transport of Mature Transcript to Cytoplasm (REACT_1281), mRNA Splicing - Major Pathway (REACT_467), Processing of Capped Intronless Pre-mRNA (REACT_1768), Gene Expression (REACT_71), Metabolism of non-coding RNA (REACT_11052), Formation of HIV-1 elongation complex in the absence of HIV-1 Tat (REACT_22201), Post-Elongation Processing of Intron-Containing pre-mRNA (REACT_397), RNA Polymerase II Transcription (REACT_1366), Transport of Mature mRNA derived from an Intron-Containing Transcript (REACT_1597), Metabolism of mRNA (REACT_20605), Post-Elongation Processing of the Transcript (REACT_78), RNA Polymerase II Transcription Elongation (REACT_833), HIV Life Cycle (REACT_6256), SLBP Dependent Processing of Replication-Dependent Histone Pre-mRNAs (REACT_1364), Formation of the Early Elongation Complex (REACT_846), Abortive elongation of HIV-1 transcript in the absence of Tat (REACT_6261), Post-Elongation Processing of Intronless pre-mRNA (REACT_717), Formation of HIV-1 elongation complex containing HIV-1 Tat (REACT_6346), Formation and Maturation of mRNA Transcript (REACT_2039), RNA Polymerase II Pre-transcription Events (REACT_22107), Tat-mediated elongation of the HIV-1 transcript (REACT_6162), Processing of Capped Intron-Containing Pre-mRNA (REACT_125), Transport of the SLBP Dependant Mature mRNA (REACT_405), HIV Infection (REACT_6185), mRNA Splicing - Minor Pathway (REACT_1753), RNA Polymerase II Transcription Termination (REACT_894), Transport of Mature mRNAs Derived from Intronless Transcripts (REACT_338), SLBP independent Processing of Histone Pre-mRNAs (REACT_185), Metabolism of RNA (REACT_21257), Late Phase of HIV Life Cycle (REACT_6361), snRNP Assembly (REACT_11066).
REACTOME_COMPLEX: ATAC C Complex [nucleoplasm] (REACT_4626), Cap Binding Complex (CBC) [nucleoplasm] (REACT_3884), Export Receptor bound mature mRNA Complex [nucleoplasm] (REACT_2624), 3 end cleaved, ligated exon containing complex [nucleoplasm] (REACT_3092), SMG1:UPF1:EJC:Translated mRNP [cytosol] (REACT_76647), Translated mRNA Complex with Premature Termination Codon Preceding Exon Junction [cytosol] (REACT_76510), upstream mRNA fragment:CPSF:PAP:PABPN1 complex [nucleoplasm] (REACT_3436), capped, methylated pre-mRNP:CBC complex [nucleoplasm] (REACT_2736), mRNA Complex with a Premature Termination Codon Not Preceding an Exon Junction [cytosol] (REACT_76342), DSIF:NELF:early elongation complex [nucleoplasm] (REACT_6594), Early elongation complex with separated aborted transcript [nucleoplasm] (REACT_6590), RNA Pol II (hypophosphorylated) complex bound to DSIF protein [nucleoplasm] (REACT_4417), Spliceosomal A Complex [nucleoplasm] (REACT_4512), DSIF:NELF:early elongation complex [nucleoplasm] (REACT_4575), Exon Junction Complex [nucleoplasm] (REACT_2984), capped intronless pre-mRNA:CBC complex [nucleoplasm] (REACT_3948), Mature Intronless transcript derived Histone mRNA:SLBP:CBP80:CBP20 [nucleoplasm] (REACT_3802), RNA Pol II (hypophosphorylated) complex bound to DSIF protein [nucleoplasm] (REACT_6426), UPF1:eRF3 Complex on Translated mRNA [cytosol] (REACT_76212), Spliceosomal Active C Complex [nucleoplasm] (REACT_2680), Capped Intronless Histone pre-mRNA:CBC complex [nucleoplasm] (REACT_3840), Aborted HIV-1 early elongation complex [nucleoplasm] (REACT_6695), lariat containing 5-end cleaved mRNA:CBC complex [nucleoplasm] (REACT_4898), Mature mRNP Complex [cytosol] (REACT_4851), HIV-1 capped pre-mRNA:CBC:RNA Pol II (phosphorylated) complex [nucleoplasm] (REACT_6374), mRNA Cleaved by SMG6 [cytosol] (REACT_76273), SMG1:Phosphorylated UPF1:EJC:Translated mRNP [cytosol] (REACT_76156), Cap Binding Complex (CBC) [cytosol] (REACT_3506), ATAC A Complex [nucleoplasm] (REACT_4037), intronless pre-mRNA cleavage complex [nucleoplasm] (REACT_3895), capped pre-mRNA:CBC:RNA Pol II (phosphorylated) complex [nucleoplasm] (REACT_3243), RNA Pol II (hypophosphorylated):capped pre-mRNA complex [nucleoplasm] (REACT_5658), Aborted early elongation complex [nucleoplasm] (REACT_3362), Mature intronless transcript derived Histone pre-mRNA:CBC complex [nucleoplasm] (REACT_5592), Ligated exon containing complex [nucleoplasm] (REACT_5472), Spliceosomal Intermediate C Complex [nucleoplasm] (REACT_5473), Capped Intronless Histone pre-mRNA:CBP80:CBP20:SLBP [nucleoplasm] (REACT_3458), Mature intronless derived mRNA complex [nucleoplasm] (REACT_4047), CstF:CPSF:capped intronless pre-mRNA:CBC complex [nucleoplasm] (REACT_3025), Spliceosomal active C complex with lariat containing, 5-end cleaved pre-mRNP:CBC complex [nucleoplasm] (REACT_5191), ATAC B Complex [nucleoplasm] (REACT_5095), capped, methylated pre-mRNA:CBC Complex [nucleoplasm] (REACT_3634), Phosphorylated UPF1:SMG5:SMG7:SMG6:PP2A:Translated mRNP [cytosol] (REACT_76275), Capped Intronless Histone pre-mRNA:CBP80:CBP20:SLBP:ZFP100 Complex [nucleoplasm] (REACT_3667), Capped Intronless Histone pre-mRNA:CBC:ZFP100 Complex [nucleoplasm] (REACT_5338), 3-polyadenylated, capped mRNA complex [nucleoplasm] (REACT_5827), CPSF:capped intronless pre-mRNA:CBC complex [nucleoplasm] (REACT_3837), Export Receptor bound mature mRNA Complex [cytosol] (REACT_2455), mRNA Complex with a Premature Termination Codon Preceding an Exon Junction [cytosol] (REACT_76207), Spliceosomal E Complex [nucleoplasm] (REACT_4545), TAP:3-polyadenylated, capped mRNA complex [nucleoplasm] (REACT_4136), m7G capped snRNA:CBC:PHAX complex [nucleoplasm] (REACT_10849), Spliceosomal B Complex [nucleoplasm] (REACT_3078), DSIF:NELF:early elongation complex after limited nucleotide addition [nucleoplasm] (REACT_6432), Translated mRNA Complex with Premature Termination Codon Not Preceding Exon Junction [cytosol] (REACT_76767), post exon ligation complex [nucleoplasm] (REACT_5793), RNA Pol II (hypophosphorylated):capped pre-mRNA complex [nucleoplasm] (REACT_6382), ATAC C Complex with lariat containing 5-end cleaved mRNA [nucleoplasm] (REACT_5134).
biological_process: mRNA processing, viral reproduction, RNA metabolic process, mRNA 3'-end processing, transcription elongation from RNA polymerase II promoter, termination of RNA polymerase II transcription, transcription from RNA polymerase II promoter, gene expression, mRNA metabolic process, spliceosomal snRNP assembly, positive regulation of viral transcription, ncRNA metabolic process, histone mRNA metabolic process, viral transcription, mRNA export from nucleus, RNA splicing, mRNA capping, nuclear mRNA splicing, via spliceosome.
These properties come from phylome analysis
molecular_function: RNA binding, RNA cap binding, protein binding, nucleic acid binding, nucleotide binding.
cellular_component: catalytic step 2 spliceosome, precatalytic spliceosome, perinuclear region of cytoplasm, microtubule associated complex, nuclear cap binding complex, mRNA cap binding complex, cytoplasm, nuclear envelope, nucleus, commitment complex.
biological_process: mRNA transport, negative regulation of viral genome replication, regulation of cell proliferation, hermaphrodite genitalia development, feminization of hermaphroditic germ-line, regulation of meiosis, positive regulation of growth rate, growth, primary microRNA processing, gene silencing by RNA, production of siRNA involved in RNA interference, cell migration, RNA interference, embryo development ending in birth or egg hatching, gonad development, RNA splicing, determination of adult lifespan, germ cell development, receptor-mediated endocytosis, mRNA capping, nematode larval development, morphogenesis of an epithelium, nuclear mRNA splicing, via spliceosome, RNA splicing, via endonucleolytic cleavage and ligation, nuclear-transcribed mRNA catabolic process, nonsense-mediated decay.
These properties come from kegg analysis
KEGG_ORTHOLOGS: nuclear cap-binding protein subunit 2 (K12883).
This polypeptide in other databases
In PhylomeDB is Phy003LGPS_CUCME .