Polypeptide MELO3C026341P2

Accession: MELO3C026341P2

Name: MELO3C026341P2

Description: Similar to Ubiquitin-conjugating enzyme E2 22 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FF66|UBC22_ARATH)

Sequence:

>MELO3C026341P2 Similar to Ubiquitin-conjugating enzyme E2 22 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FF66|UBC22_ARATH)
MATNENLPPNVIKQLAKELKSLDESPPEGIKVVVNDDDFSTIFADIEGPVGTPYENGLFRMKLILSRDFPCSPPKGYFLT
KIFHPNIATNGEICVNTLKKDWNPSLGLRHVLIVVRCLLIEPFPESALNEQAGKMLLENYDEYARHARLYTGIHAKPKPK
FKTGAISESTTALNVDPTNASALSTDLKNASATALPLACPTANSTTAVRSGQEQQQPNVVTALASESGVGVSGVGVAPAA
TVKKESGHLKMQQVDKKKIDARKKSLKRL*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: small conjugating protein ligase activity.

biological_process: regulation of protein metabolic process, post-translational protein modification, modification-dependent protein catabolic process.

These properties come from reactome analysis


REACTOME_REACTION: Interaction of E3 with substrate and E2-Ub complex (REACT_75856), Transfer of Ub from E2 to substrate and release of E2 (REACT_75901), Transfer of ubiquitin from E1 to E2 (REACT_75860).

REACTOME_PATHWAY: Adaptive Immunity Signaling (REACT_75774), Antigen processing: Ubiquitination & Proteasome degradation (REACT_75842), Immune System (REACT_6900), Class I MHC mediated antigen processing & presentation (REACT_75820).

REACTOME_COMPLEX: Ubiquitin:E2 conjugating enzymes [cytosol] (REACT_76303), Ag-substrate:E3:E2:Ub [cytosol] (REACT_76727).

biological_process: protein polyubiquitination, antigen processing and presentation of peptide antigen via MHC class I.

These properties come from phylome analysis


molecular_function: acid-amino acid ligase activity, ATP binding, protein binding, ubiquitin-protein ligase activity, small conjugating protein ligase activity.

cellular_component: anaphase-promoting complex.

biological_process: protein K6-linked ubiquitination, protein K11-linked ubiquitination, protein K63-linked ubiquitination, activation of anaphase-promoting complex activity, cell division, protein K27-linked ubiquitination, protein K29-linked ubiquitination, anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process, free ubiquitin chain polymerization, exit from mitosis, ubiquitin-dependent protein catabolic process, regulation of protein metabolic process, post-translational protein modification.

These properties come from kegg analysis


KEGG_ORTHOLOGS: ubiquitin-conjugating enzyme E2 S [EC:6.3.2.19] (K10583).

Locations

Located in CM3.5_scaffold00091 from 664784 to 667215.

This polypeptide in other databases

In PhylomeDB is Phy003ADAL_CUCME .

Related features