Polypeptide MELO3C026349P1

Accession: MELO3C026349P1

Name: MELO3C026349P1

Description: Similar to DNA repair protein recA homolog 2, mitochondrial (Arabidopsis thaliana) (uniprot_sprot:sp|Q8RY99|RECAM_ARATH)

Sequence:

>MELO3C026349P1 Similar to DNA repair protein recA homolog 2, mitochondrial (Arabidopsis thaliana) (uniprot_sprot:sp|Q8RY99|RECAM_ARATH)
MSFLAHSLFRSCRLKHFEASRFSSLFHFLGQGRRDVISCMGIDACHFSSLVDVWEYECDMLNDDTKTTEKDTALHSAISR
VAADFGKESKLFLQRSFSSRYAHVISTGSLKLDIALGIGGLPKGRIIEIYGQEASGKTTLALHIIKEAQKLGGYCAYFDA
ENAMDMSFAESMGVNVDNLLISPPASAENLLCAVNTLVRSGSVDVIVVDTVAALVPQCELDAPIGSSERDSRPRVMNQAL
RKIHYSLKLSQTLIVFINQVRSAGYQNDFEQKDEVTCGGNALQFYAAIRLRLLRKGLLKRGDKVTGLAVSVQVVKNKLAS
SMKMAELGIHFGRGFCCESEVLELGCEHGVILKDKSNFHIEGRICSSKHEAEQYLMENEDVLHKVVEILRNQLFIQESSP
*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: Association of RAD51 with the resected ends of the DNA double-strand break (REACT_105477).

biological_process: DNA recombinase assembly, double-strand break repair via homologous recombination, double-strand break repair, DNA repair.

REACTOME_PATHWAY: Double-Strand Break Repair (REACT_97002), Homologous DNA pairing and strand exchange (REACT_95872), Presynaptic phase of homologous DNA pairing and strand exchange (REACT_85680), Assembly of the RAD51-ssDNA nucleoprotein complex (REACT_82066), DNA Repair (REACT_91442), Homologous recombination repair of replication-independent double-strand breaks (REACT_81884), Homologous Recombination Repair (REACT_103005).

These properties come from phylome analysis


molecular_function: calcium-transporting ATPase activity, DNA-dependent ATPase activity, ATP binding, single-stranded DNA binding.

cellular_component: mitochondrion.

biological_process: response to heat, DNA recombination, mitochondrial genome maintenance, DNA repair.

These properties come from blast2go analysis


molecular_function: DNA-dependent ATPase activity, ATP binding, single-stranded DNA binding.

cellular_component: mitochondrion.

biological_process: DNA repair.

Locations

Located in CM3.5_scaffold00091 from 826811 to 840829.

This polypeptide in other databases

In PhylomeDB is Phy003A4HC_CUCME .

Related features