Polypeptide MELO3C026579P1
Accession: MELO3C026579P1
Name: MELO3C026579P1
Description: Similar to ATP synthase subunit alpha, chloroplastic (Cucumis sativus) (uniprot_sprot:sp|Q2QDA3|ATPA_CUCSA)
Sequence:
>MELO3C026579P1 Similar to ATP synthase subunit alpha, chloroplastic (Cucumis sativus) (uniprot_sprot:sp|Q2QDA3|ATPA_CUCSA) MALNFESNNVGVVLMGDGLLIQEGSSVKATGRIAQIPVSEAYLGRVINVLAKPIDGRGEISS*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: proton-transporting ATPase activity, rotational mechanism, hydrogen ion transporting ATP synthase activity, rotational mechanism, ATP binding.
cellular_component: proton-transporting ATP synthase complex, catalytic core F(1), chloroplast thylakoid membrane, mitochondrion.
biological_process: plasma membrane ATP synthesis coupled proton transport.
This polypeptide in other databases
In PhylomeDB is Phy003LL87_CUCME .

