Polypeptide MELO3C026888P1
Accession: MELO3C026888P1
Name: MELO3C026888P1
Description: Similar to T-complex protein 1 subunit theta (Dictyostelium discoideum) (uniprot_sprot:sp|Q552J0|TCPQ_DICDI)
Sequence:
>MELO3C026888P1 Similar to T-complex protein 1 subunit theta (Dictyostelium discoideum) (uniprot_sprot:sp|Q552J0|TCPQ_DICDI) MGFQLPSHGIQSMLKEGHKHFSGLDEAVLKNIDACKQLSTITRTSLGPNGMNKMVINHLDKLFVTNDAATIVNELEVQHP AAKLLVLAGKAQQEEIGDGANLTISFAGELLQNAEELIRMGLHPSEIISGYTKGINKTIEVLKELVEKGSENMDVRNKEE VVSRMKAAVASKQFGQEDFICSLVADACIQVCPKNPENFNVDNVRVAKLLGGGLHNSSVVRGMVLKSDAVGSIKRIEKAK VAVFAGGVDTSATETKGTVLIHTAEELQNYAKTEEAKVEELIKAVADSGAKVIVSGAAVGEMALHFCERYKLMVLKISSK FELRRFCRTTGAVAMLKLSQPNPDDLGHVDSVSVEEIGGVRVTVVKNEEGGNSISTVVLRGSTDSILDDLERAVDDGVNT YKAMAKDSRTVPGAAATEIELARRVKEFSFKETGLDQYAIAKFAESFEMVPKTLSENAGLNAMEIISSLYAEHASGNTRV GIDLEEGICKDVSTMNIWDLYITKFFALKYAADAACTVLRVDQIIMSKPAGGPRRGDQPAGMDED*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: unfolded protein binding, ATP binding.
cellular_component: membrane, cytoplasm.
biological_process: protein folding.
These properties come from reactome analysis
REACTOME_REACTION: Hydrolysis of ATP and release of folded actin from CCT/TriC (REACT_16915), Hydrolysis of ATP and release of folded actin from CCT/TriC (REACT_78266), Actin/tubulin:prefoldin complex associates with CCT/TriC (REACT_91786), Actin/tubulin:prefoldin complex associates with CCT/TriC (REACT_82740), Hydrolysis of ATP and release of folded actin from CCT/TriC (REACT_29657), Association of CCT/TriC with sphingosine kinase 1 (REACT_30990), ADP is exchanged for ATP in the (ADP:CCT/TriC):tubulin complex (REACT_95060), ADP is exchanged for ATP in the (ADP:CCT/TriC):tubulin complex (REACT_87725), Exchange of ADP for ATP in CCT/TriC:actin complex (REACT_89562), Actin/tubulin:prefoldin complex associates with CCT/TriC (REACT_79699), Exchange of ADP for ATP in CCT/TriC:actin complex (REACT_110464), Association of CCT/TriC with sphingosine kinase 1 (REACT_79248), ADP is exchanged for ATP in the (ADP:CCT/TriC):tubulin complex (REACT_16909), Hydrolysis of ATP and release of folded actin from CCT/TriC (REACT_106704), Hydrolysis of ATP and release of tubulin folding intermediate from CCT/TriC (REACT_105093), Exchange of ADP for ATP in CCT/TriC:actin complex (REACT_99841), Actin/tubulin:prefoldin complex associates with CCT/TriC (REACT_110891), Exchange of ADP for ATP in CCT/TriC:actin complex (REACT_105754), Association of CCT/TriC with sphingosine kinase 1 (REACT_103156), Association of CCT/TriC with sphingosine kinase 1 (REACT_16980), Association of CCT/TriC with other substrates during biosynthesis (unknown chaperone) (REACT_16984), Exchange of ADP for ATP in CCT/TriC:actin complex (REACT_111017), Hydrolysis of ATP and release of tubulin folding intermediate from CCT/TriC (REACT_17032), Exchange of ADP for ATP in CCT/TriC:actin complex (REACT_17011), Association of CCT/TriC with sphingosine kinase 1 (REACT_106470), Hydrolysis of ATP and release of tubulin folding intermediate from CCT/TriC (REACT_34756), ADP is exchanged for ATP in the (ADP:CCT/TriC):tubulin complex (REACT_33435), ADP is exchanged for ATP in the (ADP:CCT/TriC):tubulin complex (REACT_100652), ADP is exchanged for ATP in the (ADP:CCT/TriC):tubulin complex (REACT_32597), Actin/tubulin:prefoldin complex associates with CCT/TriC (REACT_109317), Actin/tubulin:prefoldin complex associates with CCT/TriC (REACT_16961).
biological_process: chaperone mediated protein folding independent of cofactor, cellular protein metabolic process, 'de novo' posttranslational protein folding, protein folding.
REACTOME_COMPLEX: CCT/TriC (ADP) associated actin [cytosol] (REACT_17090), CCT/TriC(ATP):unfolded tubulin complex [cytosol] (REACT_17889), CCT/TriC:substrate complex [cytosol] (REACT_17268), CCT/TriC(ATP)-associated actin [cytosol] (REACT_17160), actin/tubulin-bound CCT/TriC(ADP) [cytosol] (REACT_17195), CCT/TriC(ADP)-associated non-native tubulin [cytosol] (REACT_17102), CCT/TriC(ATP) [cytosol] (REACT_17683), CCT/TriC(ADP) [cytosol] (REACT_17874), CCT/TriC(ADP):Sphingosine kinase 1 [cytosol] (REACT_18085).
REACTOME_PATHWAY: Association of TriC/CCT with target proteins during biosynthesis (REACT_29094), Prefoldin mediated transfer of substrate to CCT/TriC (REACT_16936), Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding (REACT_78563), Protein folding (REACT_16952), Association of TriC/CCT with target proteins during biosynthesis (REACT_31856), Formation of tubulin folding intermediates by CCT/TriC (REACT_16956), Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding (REACT_87227), Folding of actin by CCT/TriC (REACT_84125), Protein folding (REACT_90475), Prefoldin mediated transfer of substrate to CCT/TriC (REACT_93325), Chaperonin-mediated protein folding (REACT_104912), Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding (REACT_17029), Chaperonin-mediated protein folding (REACT_17004), Metabolism of proteins (REACT_91052), Protein folding (REACT_100416), Folding of actin by CCT/TriC (REACT_86026), Chaperonin-mediated protein folding (REACT_100411), Folding of actin by CCT/TriC (REACT_91038), Protein folding (REACT_34382), Metabolism of proteins (REACT_85873), Folding of actin by CCT/TriC (REACT_88264), Chaperonin-mediated protein folding (REACT_30906), Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding (REACT_91371), Formation of tubulin folding intermediates by CCT/TriC (REACT_98132), Association of TriC/CCT with target proteins during biosynthesis (REACT_16907), Formation of tubulin folding intermediates by CCT/TriC (REACT_77963), Prefoldin mediated transfer of substrate to CCT/TriC (REACT_110445), Prefoldin mediated transfer of substrate to CCT/TriC (REACT_80983), Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding (REACT_94344), Protein folding (REACT_85464), Formation of tubulin folding intermediates by CCT/TriC (REACT_81155), Formation of tubulin folding intermediates by CCT/TriC (REACT_86318), Association of TriC/CCT with target proteins during biosynthesis (REACT_32002), Metabolism of proteins (REACT_86658), Metabolism of proteins (REACT_99179), Folding of actin by CCT/TriC (REACT_95493), Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding (REACT_101105), Metabolism of proteins (REACT_17015), Chaperonin-mediated protein folding (REACT_106927), Formation of tubulin folding intermediates by CCT/TriC (REACT_107029), Folding of actin by CCT/TriC (REACT_17050), Chaperonin-mediated protein folding (REACT_32155), Prefoldin mediated transfer of substrate to CCT/TriC (REACT_34237), Association of TriC/CCT with target proteins during biosynthesis (REACT_97707), Prefoldin mediated transfer of substrate to CCT/TriC (REACT_81425), Metabolism of proteins (REACT_102155), Protein folding (REACT_30135).
These properties come from phylome analysis
molecular_function: ATPase activity, uncoupled, ATPase activity, coupled, ATPase activity, unfolded protein binding, ATP binding.
cellular_component: intermediate filament cytoskeleton, aggresome, microtubule associated complex, chaperonin-containing T-complex, cytosol, microtubule organizing center, nucleus, membrane, cytoplasm.
biological_process: 'de novo' posttranslational protein folding, inductive cell migration, hermaphrodite genitalia development, positive regulation of growth rate, growth, cytoplasmic microtubule organization, embryo development ending in birth or egg hatching, mitotic spindle organization, receptor-mediated endocytosis, nematode larval development, protein folding.
These properties come from kegg analysis
KEGG_ORTHOLOGS: T-complex protein 1 subunit theta (K09500).
This polypeptide in other databases
In PhylomeDB is Phy003AC9D_CUCME .

