Polypeptide MELO3C027090P1
Accession: MELO3C027090P1
Name: MELO3C027090P1
Description: Similar to ATP-dependent Clp protease proteolytic subunit (Morus indica) (uniprot_sprot:sp|Q09WZ2|CLPP_MORIN)
Sequence:
>MELO3C027090P1 Similar to ATP-dependent Clp protease proteolytic subunit (Morus indica) (uniprot_sprot:sp|Q09WZ2|CLPP_MORIN) MVYLSMENDTKDLYLFINSPGGGVISGLGIYDTMQFVQPHVQTVCMGLAASMGSFILVGGEITKRLAFPHARRQ*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: ATP binding, serine-type endopeptidase activity.
cellular_component: chloroplast.
biological_process: proteolysis.
These properties come from phylome analysis
molecular_function: ATP binding, serine-type endopeptidase activity.
cellular_component: mitochondrial matrix.
biological_process: hermaphrodite genitalia development, positive regulation of multicellular organism growth, positive regulation of locomotion, positive regulation of growth rate, growth, protein catabolic process, body morphogenesis, embryo development ending in birth or egg hatching, receptor-mediated endocytosis, nematode larval development, proteolysis.
This polypeptide in other databases
In PhylomeDB is Phy003MIL6_CUCME .
