Polypeptide MELO3C027184P1
Accession: MELO3C027184P1
Name: MELO3C027184P1
Description: Similar to DNA primase small subunit (Homo sapiens) (uniprot_sprot:sp|P49642|PRI1_HUMAN)
Sequence:
>MELO3C027184P1 Similar to DNA primase small subunit (Homo sapiens) (uniprot_sprot:sp|P49642|PRI1_HUMAN) PAKRHAYAGDNVFTPVERELVFDIDMTDYDDVRYCCSGADVCLDCWPLMTAAIKVIDTTLRDDFGFNHILWVFSGRRGVH CWVCDGKARRLSNEQRAAIAEYFHLYQGNENSRKKISLTGPVLHPFLARSYTEVLKDSFESQLLYMIPDESITSDLRGRW QDNRRSSKNDVNSLRWEQLKNLLQSGKHKAQGMRRHVEEIVFSFTYPRLDLE
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: DNA primase activity.
cellular_component: alpha DNA polymerase:primase complex.
biological_process: DNA replication, synthesis of RNA primer.
These properties come from reactome analysis
REACTOME_REACTION: RFC dissociates after sliding clamp formation (REACT_94070), Loading of PCNA - Sliding Clamp Formation (REACT_1994), RPA binds to the Flap (REACT_2026), Detection of damage during initiation of DNA synthesis in S-phase (REACT_29711), Removal of remaining Flap (REACT_2024), Detection of damage during initiation of DNA synthesis in S-phase (REACT_106773), Loading of PCNA - Sliding Clamp Formation (REACT_84790), RFC binding displaces Pol Alpha (REACT_107444), RFC binding displaces Pol Alpha (REACT_95802), The primase component of DNA polymerase:primase synthesizes a 6-10 nucleotide RNA primer at the origin (REACT_1611), The polymerase component of DNA polymerase alpha:primase synthesizes a 20-nucleotide primer at the origin (REACT_91), RFC binding displaces Pol Alpha (REACT_100925), Formation of Processive Complex (REACT_1009), The primase component of DNA polymerase:primase synthesizes a 6-10 nucleotide RNA primer on the G strand of the telomere (REACT_90432), The primase component of DNA polymerase:primase synthesizes a 6-10 nucleotide RNA primer on the G strand of the telomere (REACT_7998), Formation of the Flap Intermediate (REACT_1572), DNA polymerase alpha:primase binds at the origin (REACT_929), RFC binding displaces Pol Alpha on the C-strand of the telomere (REACT_8008), Detection of damage during initiation of DNA synthesis in S-phase (REACT_89912), Formation of Okazaki fragments (REACT_1024), DNA polymerase alpha:primase binds at the origin (REACT_97571), The polymerase component of DNA polymerase alpha:primase synthesizes a 20-nucleotide primer on the G strand of the telomere (REACT_8004), The polymerase component of DNA polymerase alpha:primase synthesizes a 20-nucleotide primer on the G strand of the telomere (REACT_82246), The polymerase component of DNA polymerase alpha:primase synthesizes a 20-nucleotide primer at the origin (REACT_78796), DNA polymerase alpha:primase binds at the origin (REACT_103858), DNA polymerase alpha:primase binds at the origin (REACT_98987), RFC binding displaces Pol Alpha on the C-strand of the telomere (REACT_107682), The polymerase component of DNA polymerase alpha:primase synthesizes a 20-nucleotide primer at the origin (REACT_85611), The primase component of DNA polymerase:primase synthesizes a 6-10 nucleotide RNA primer at the origin (REACT_91945), Recruitment of Dna2 endonuclease (REACT_1278), RFC binding displaces Pol Alpha on the C-strand of the telomere (REACT_98653), RFC binding displaces Pol Alpha (REACT_1871), RFC dissociates after sliding clamp formation (REACT_351), The primase component of DNA polymerase:primase synthesizes a 6-10 nucleotide RNA primer on the G strand of the telomere (REACT_97374), The primase component of DNA polymerase:primase synthesizes a 6-10 nucleotide RNA primer at the origin (REACT_31831), The polymerase component of DNA polymerase alpha:primase synthesizes a 20-nucleotide primer at the origin (REACT_108640), The primase component of DNA polymerase:primase synthesizes a 6-10 nucleotide RNA primer at the origin (REACT_91186), Detection of damage during initiation of DNA synthesis in S-phase (REACT_1408), Removal of RNA primer and dissociation of RPA and Dna2 (REACT_315), Loading of PCNA - Sliding Clamp Formation (REACT_89203), Loading of PCNA - Sliding Clamp Formation (REACT_98979), The polymerase component of DNA polymerase alpha:primase synthesizes a 20-nucleotide primer on the G strand of the telomere (REACT_110309), The primase component of DNA polymerase:primase synthesizes a 6-10 nucleotide RNA primer on the G strand of the telomere (REACT_83805), RFC binding displaces Pol Alpha on the C-strand of the telomere (REACT_108876), RFC dissociates after sliding clamp formation (REACT_108877), RFC dissociates after sliding clamp formation (REACT_90684), The polymerase component of DNA polymerase alpha:primase synthesizes a 20-nucleotide primer on the G strand of the telomere (REACT_91124).
biological_process: mitotic cell cycle, telomere maintenance, telomere maintenance via semi-conservative replication, DNA strand elongation involved in DNA replication, DNA-dependent DNA replication initiation, telomere maintenance via recombination, M/G1 transition of mitotic cell cycle, S phase of mitotic cell cycle, G1/S transition of mitotic cell cycle.
REACTOME_COMPLEX: Processive complex [nucleoplasm] (REACT_3120), DNA polymerase alpha:primase:DNA polymerase alpha:G-strand extended telomere end [nucleoplasm] (REACT_8177), Processive complex:nicked DNA from adjacent Okazaki fragments [nucleoplasm] (REACT_4371), DNA polymerase alpha:primase [nucleoplasm] (REACT_3725), RNA primer-DNA primer:origin duplex [nucleoplasm] (REACT_5497), Processive complex:Okazaki fragment complex [nucleoplasm] (REACT_5537), RNA primer-DNA primer:origin duplex:PCNA [nucleoplasm] (REACT_4810), Processive complex:Okazaki fragment:Flap:RPA heterotrimer [nucleoplasm] (REACT_4699), DNA polymerase alpha:primase:DNA polymerase alpha:origin complex [nucleoplasm] (REACT_3167), RNA primer:origin duplex:DNA polymerase alpha:primase complex [nucleoplasm] (REACT_5709), Processive complex:Okazaki fragments:Remaining Flap [nucleoplasm] (REACT_4338), Processive complex:Okazaki fragment:Flap [nucleoplasm] (REACT_4984), RFC Heteropentamer:RNA primer-DNA primer:origin duplex:PCNA homotrimer [nucleoplasm] (REACT_5474), RNA primer-DNA primer:G-strand extended telomere [nucleoplasm] (REACT_8560), RFC Heteropentamer:RNA primer-DNA primer:origin duplex [nucleoplasm] (REACT_5241), RNA primer:G-strand extended telomere end:DNA polymerase alpha:primase complex [nucleoplasm] (REACT_8504), Processive complex:Okazaki fragment:Flap:RPA heterotrimer:dna2 [nucleoplasm] (REACT_3597).
REACTOME_PATHWAY: Polymerase switching (REACT_108196), Mitotic G1-G1/S phases (REACT_28641), Telomere C-strand (Lagging Strand) Synthesis (REACT_31770), DNA Replication (REACT_383), Telomere C-strand synthesis initiation (REACT_29561), Telomere C-strand (Lagging Strand) Synthesis (REACT_103027), Telomere C-strand (Lagging Strand) Synthesis (REACT_7961), Mitotic G1-G1/S phases (REACT_21267), Mitotic M-M/G1 phases (REACT_21300), Lagging Strand Synthesis (REACT_33812), Leading Strand Synthesis (REACT_88618), Activation of the pre-replicative complex (REACT_33508), Leading Strand Synthesis (REACT_1838), Extension of Telomeres (REACT_85592), E2F mediated regulation of DNA replication (REACT_79760), E2F mediated regulation of DNA replication (REACT_108370), DNA Replication (REACT_101785), G1/S Transition (REACT_87037), Polymerase switching on the C-strand of the telomere (REACT_29268), Mitotic G1-G1/S phases (REACT_93079), Telomere Maintenance (REACT_7970), Polymerase switching on the C-strand of the telomere (REACT_104638), Synthesis of DNA (REACT_29575), Synthesis of DNA (REACT_77553), E2F mediated regulation of DNA replication (REACT_471), Activation of the pre-replicative complex (REACT_89455), Telomere Maintenance (REACT_86038), DNA strand elongation (REACT_932), G1/S Transition (REACT_45711), Synthesis of DNA (REACT_31294), Inhibition of replication initiation of damaged DNA by Rb/E2F1 (REACT_95756), M/G1 Transition (REACT_108301), DNA replication initiation (REACT_104509), Cell Cycle, Mitotic (REACT_96281), Cell Cycle, Mitotic (REACT_152), Removal of the Flap Intermediate (REACT_70), DNA strand elongation (REACT_107311), Chromosome Maintenance (REACT_22172), Synthesis of DNA (REACT_2014), Inhibition of replication initiation of damaged DNA by Rb/E2F1 (REACT_106235), DNA replication initiation (REACT_2244), S Phase (REACT_899), Lagging Strand Synthesis (REACT_104953), Mitotic M-M/G1 phases (REACT_80279), Polymerase switching on the C-strand of the telomere (REACT_7987), Activation of the pre-replicative complex (REACT_104362), Telomere Maintenance (REACT_78680), Cell Cycle, Mitotic (REACT_84794), S Phase (REACT_105829), Telomere C-strand (Lagging Strand) Synthesis (REACT_85706), DNA strand elongation (REACT_83094), M/G1 Transition (REACT_110210), Inhibition of replication initiation of damaged DNA by Rb/E2F1 (REACT_40372), Mitotic M-M/G1 phases (REACT_95347), Telomere C-strand synthesis initiation (REACT_7993), Telomere C-strand synthesis initiation (REACT_91624), M/G1 Transition (REACT_79481), E2F mediated regulation of DNA replication (REACT_34288), DNA Replication Pre-Initiation (REACT_98069), Mitotic M-M/G1 phases (REACT_93881), DNA Replication Pre-Initiation (REACT_734), Cell Cycle, Mitotic (REACT_108233), S Phase (REACT_89318), Processive synthesis on the lagging strand (REACT_1385), DNA strand elongation (REACT_84140), Polymerase switching (REACT_89784), Telomere Maintenance (REACT_87184), DNA Replication (REACT_96557), Extension of Telomeres (REACT_81460), G1/S Transition (REACT_104577), DNA replication initiation (REACT_89418), Leading Strand Synthesis (REACT_78985), Lagging Strand Synthesis (REACT_76929), Activation of the pre-replicative complex (REACT_1095), Inhibition of replication initiation of damaged DNA by Rb/E2F1 (REACT_329), G1/S Transition (REACT_1783), Chromosome Maintenance (REACT_85555), Chromosome Maintenance (REACT_90690), DNA Replication (REACT_106731), Extension of Telomeres (REACT_8030), Polymerase switching (REACT_84976), S Phase (REACT_81914), Extension of Telomeres (REACT_78552), Telomere C-strand synthesis initiation (REACT_97211), DNA Replication Pre-Initiation (REACT_109296), Leading Strand Synthesis (REACT_79904), M/G1 Transition (REACT_1725), Chromosome Maintenance (REACT_94920), Lagging Strand Synthesis (REACT_312), Mitotic G1-G1/S phases (REACT_87718), DNA Replication Pre-Initiation (REACT_32026), Polymerase switching (REACT_1792), Polymerase switching on the C-strand of the telomere (REACT_102170), DNA replication initiation (REACT_97560).
These properties come from phylome analysis
molecular_function: metal ion binding, ATP binding, protein binding, DNA primase activity.
cellular_component: nucleoplasm, alpha DNA polymerase:primase complex.
biological_process: telomere maintenance via semi-conservative replication, transcription, DNA-dependent, DNA strand elongation involved in DNA replication, DNA-dependent DNA replication initiation, telomere maintenance via recombination, M/G1 transition of mitotic cell cycle, S phase of mitotic cell cycle, G1/S transition of mitotic cell cycle, DNA replication, synthesis of RNA primer.
These properties come from kegg analysis
KEGG_REACTION: deoxythymidine (R00378), Deoxycytidine (R00377), Deoxyguanosine (R00376), Deoxyadenosine (R00375).
KEGG_ORTHOLOGS: DNA primase small subunit [EC:2.7.7.-] (K02684).
molecular_function: DNA primase activity.
COG: Eukaryotic-type DNA primase, catalytic (small) subunit (COG1467).
Partial gene: true
This polypeptide in other databases
In PhylomeDB is Phy003ME95_CUCME .
