Polypeptide MELO3C027223P1
Accession: MELO3C027223P1
Name: MELO3C027223P1
Description: Similar to Chromatin regulatory protein sir2, putative (Ricinus communis) (uniref90:UniRef90_B9RRG6)
Sequence:
>MELO3C027223P1 Similar to Chromatin regulatory protein sir2, putative (Ricinus communis) (uniref90:UniRef90_B9RRG6) WAEAIESLDDGVPGSDKSFGMKQRPGGDIEIDEKYWEHDFCIPTCQKCNGVLKPD
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: NAD+ binding, NAD-dependent histone deacetylase activity, zinc ion binding.
cellular_component: mitochondrion.
biological_process: protein deacetylation, chromatin silencing.
Partial gene: true
This polypeptide in other databases
In PhylomeDB is Phy003MGTF_CUCME .