Polypeptide MELO3C007042P1

Accession: MELO3C007042P1

Name: MELO3C007042P1

Description: Similar to Coatomer subunit epsilon-2 (Arabidopsis thaliana) (uniprot_sprot:sp|O64748|COPE2_ARATH)

Sequence:

>MELO3C007042P1 Similar to Coatomer subunit epsilon-2 (Arabidopsis thaliana) (uniprot_sprot:sp|O64748|COPE2_ARATH)
MAAPDHLFNLRNNFYLGAYQAAINNSDLPNLSPDDAIERDSIVFRSYIALGSYQLAISEIDSSAPTPLQAVKLLALYLSD
PSNKESTIASLQEWLSDPAIGNNPTLRLIAGIIFMHEQDYNEALKHTNAGGTMELHALNVQIFLKMHRSDYAERQLRVMQ
QIDEDHTLTQLANAWLNLAVGGSKIQEAYLIFQDFSEKYPMTSLILNGRAVCCMHMGNFDEAETLLLEALNKDAKDPETL
ANLVVCNLHLGKPTSRFLSQLKLSHPDHMLVKRISTAEENFDRAVQSVA*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: Coat Complex Formation (REACT_11243), GAP Recruitment to the Coatomer:Arf1-GTP Complex (REACT_11111), GAP Recruitment to the Coatomer:Arf1-GTP Complex (REACT_89009), Sculpting and pinching-off of Golgi vessicle (REACT_87018), Coat Complex Formation (REACT_110428), Sculpting and pinching-off of Golgi vessicle (REACT_28200), Coat Complex Formation (REACT_80819), Coat Complex Formation (REACT_99497), Sculpting and pinching-off of Golgi vessicle (REACT_11138), GAP Recruitment to the Coatomer:Arf1-GTP Complex (REACT_109267), Sculpting and pinching-off of Golgi vessicle (REACT_83563).

biological_process: cellular membrane organization, COPI coating of Golgi vesicle, retrograde vesicle-mediated transport, Golgi to ER.

REACTOME_COMPLEX: Coatomer:Arf1-GDP:GAP Complex [Golgi membrane] (REACT_11510), Coatomer:Arf1-GTP Complex [Golgi membrane] (REACT_11791), Coatomer:GAP Complex [Golgi membrane] (REACT_11710), Coatomer [cytosol] (REACT_11329), Coatomer:GAP Complex [Golgi-associated vesicle membrane] (REACT_11857), Coatomer:Arf1-GTP:GAP Complex [Golgi membrane] (REACT_11350).

REACTOME_PATHWAY: Membrane Trafficking (REACT_86557), Membrane Trafficking (REACT_11123), Golgi to ER Retrograde Transport (REACT_11208), Golgi to ER Retrograde Transport (REACT_84617), COPI Mediated Transport (REACT_85460), COPI Mediated Transport (REACT_82601), Golgi to ER Retrograde Transport (REACT_88525), Golgi to ER Retrograde Transport (REACT_106254), Membrane Trafficking (REACT_87431), Membrane Trafficking (REACT_34084), COPI Mediated Transport (REACT_97338), COPI Mediated Transport (REACT_11096).

These properties come from phylome analysis


molecular_function: binding, protein binding, structural molecule activity.

cellular_component: microtubule associated complex, cytosol, COPI vesicle coat.

biological_process: COPI coating of Golgi vesicle, locomotion, positive regulation of growth rate, protein transport, intra-Golgi vesicle-mediated transport, nematode larval development, retrograde vesicle-mediated transport, Golgi to ER.

These properties come from blast2go analysis


molecular_function: protein binding, structural molecule activity.

cellular_component: COPI vesicle coat.

biological_process: retrograde vesicle-mediated transport, Golgi to ER.

Locations

Located in CM3.5_scaffold00007 from 419709 to 422840.

This polypeptide in other databases

In PhylomeDB is Phy003ACW6_CUCME .

Related features