Polypeptide MELO3C007066P1
Accession: MELO3C007066P1
Name: MELO3C007066P1
Description: Similar to Origin recognition complex subunit 1 (Drosophila melanogaster) (uniprot_sprot:sp|O16810|ORC1_DROME)
Sequence:
>MELO3C007066P1 Similar to Origin recognition complex subunit 1 (Drosophila melanogaster) (uniprot_sprot:sp|O16810|ORC1_DROME) MSRRSTRLVEKASASRTNGYVVSEGDLKAHRRSRTWTENNEVKLNEVMFSPSFQQLEGKKRKTYKKRSMVTRATASKNPN SEEGINKRGSGRLRKRVYYQKVVFDGGEFEVGDDVYVRRREDASSDDEDPEVEECRVCFKSGNAVMIECDDCLGGFHLKC LKPPMKVIPEGDWICGFCEAAKMGKEVQLPKPPEGKKRVRTMREKLLAGDLWAAHIESIWKEVTGNHQCKVRWYIIPEET AAGRQPHNLKRELYLTNDFADIEMESLLRLCEVMNPKDYYKAKEGDDIFLCEYKYDVRWHSFKRLAEIDKEQDTEAVDSD TEWKLDQNADSDSDGDVEYEEERAQILLSRNYSSSTHELAANSRKGHFCGLQKIGAKKIPEHTRCRKQTELERAKATLML ASLPKSLPCRNKEIEEITTFIESALCDDQCLGRCLYIYGVPGTGKTMSVLSVMRNLRAKVDAGNLRPHCFVEVNGLKLAA PENIYRVIHEALTGHRVHWKKALQLLTKRFSDVNSCRNDERPCILLIDELDLLVTRNQSILYNILDWPTKPQAKLIVIGI ANTMDLPEKLLPRISSRMGIERLCFGPYNHQQLQEIILSRLEGINAFEKQAIEFASRKVAAISGDARRALEICRRAAEIM DYHLKKHLSLISNTAKTHVGIAEVETAIQEMFQAPHIQVMKSCSKQSKIFLTAMVHDYYKTGLGEATFEKLAMTFSNLCT SNGEEFPGYDALLKVGCRLGESRIILCESGAKHRLQKLQLNVPSDDVSFALKDSKDIPWLAKYL*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: nucleoside-triphosphatase activity, oxidoreductase activity, zinc ion binding, ATP binding, protein binding, DNA binding.
cellular_component: plastid, nucleus, origin recognition complex.
biological_process: oxidation-reduction process, regulation of transcription, DNA-dependent, DNA replication.
These properties come from reactome analysis
REACTOME_REACTION: Mcm10 associates with the pre-replicative complex, stabilizing Mcm2-7 (REACT_541), Free CDT1 associates with CDC6:ORC:origin complexes (REACT_1975), Orc1 associates with Orc4:Orc5:Orc3:Orc2:origin complexes (REACT_664), Cdt1 is displaced from the pre-replicative complex. (REACT_951), Phosphorylated Orc1 is ubiquitinated while still associated with chromatin (REACT_31068), DNA Replication Factor A (RPA) associates with the pre-replicative complex at the origin (REACT_789), CDC6 association with ORC:origin complexes mediated by MCM8 (REACT_85156), Cdc45 associates with the pre-replicative complex at the origin (REACT_135), CDC6 association with ORC:origin complexes mediated by MCM8 (REACT_282), Mcm2-7 associates with the Cdt1:CDC6:ORC:origin complex, forming the pre-replicative complex (preRC) (REACT_32416), Cytoplasmic phosphorylated Cdc6 is ubiquitinated by the anaphase-promoting complex (REACT_1673), Orc6 associates with Orc1:Orc4:Orc5:Orc3:Orc2:origin complexes, forming ORC:origin complexes (REACT_984), Association of MCM8 with ORC:origin complex (REACT_6731), Loading of claspin onto DNA during replication origin firing (REACT_6738), Phosphorylated Cdc6 is exported from the nucleus (REACT_448), Activation of claspin (REACT_6750), Association of MCM8 with ORC:origin complex (REACT_96893), Ubiquitinated Orc1 enters the cytosol (REACT_98003), Association of Cyclin B/Cdk1 with replicative origin inhibits pre-RC formation (REACT_555), Orc1 is phosphorylated by cyclin A/CDK2 (REACT_2111), Phosphorylated Orc1 is ubiquitinated while still associated with chromatin (REACT_1626), Cdc45 associates with the pre-replicative complex at the origin (REACT_108604), Mcm10 associates with the pre-replicative complex, stabilizing Mcm2-7 (REACT_98657), Cdc6 protein is phosphorylated by CDK (REACT_1279), Orc1 associates with Orc4:Orc5:Orc3:Orc2:origin complexes (REACT_78929), CDK and DDK associate with the Mcm10:pre-replicative complex (REACT_2227), Ubiquitinated Orc1 enters the cytosol (REACT_210), Mcm2-7 associates with the Cdt1:CDC6:ORC:origin complex, forming the pre-replicative complex (preRC) (REACT_1770), Orc6 associates with Orc1:Orc4:Orc5:Orc3:Orc2:origin complexes, forming ORC:origin complexes (REACT_106513).
biological_process: cell cycle checkpoint, M/G1 transition of mitotic cell cycle, mitotic cell cycle, G1/S transition of mitotic cell cycle, S phase of mitotic cell cycle, DNA replication.
REACTOME_COMPLEX: pre-replicative complex [nucleoplasm] (REACT_4388), CDT1:CDC6:ORC:origin complex [nucleoplasm] (REACT_5333), Cdc45:CDK:DDK:Mcm10:pre-replicative complex [nucleoplasm] (REACT_4546), ubiquitinated Cdc6 [cytosol] (REACT_5308), CDK:DDK:Mcm10:pre-replicative complex [nucleoplasm] (REACT_2458), ORC:origin:cyclin B:cdk1 complex [nucleoplasm] (REACT_4235), Cdc45:CDK:DDK:Mcm10:Activated claspin:pre-replicative complex [nucleoplasm] (REACT_7262), active pre-replicative complex [nucleoplasm] (REACT_5627), RPA:Cdc45:CDK:DDK:Mcm10:pre-replicative complex [nucleoplasm] (REACT_2568), Mcm10:pre-replicative complex [nucleoplasm] (REACT_5685), ORC complex bound to origin [nucleoplasm] (REACT_7859), CDC6:ORC:origin complex [nucleoplasm] (REACT_4079), ORC:origin [nucleoplasm] (REACT_3844), Mcm10:active pre-replicative complex [nucleoplasm] (REACT_2683), ubiquitinated Orc1 [cytosol] (REACT_5173), pre-replicative complex (Orc1-minus) [nucleoplasm] (REACT_3695), Cdc45:CDK:DDK:Mcm10:claspin:pre-replicative complex [nucleoplasm] (REACT_7273), ubiquitinated Orc1 [nucleoplasm] (REACT_5402), Orc1:Orc4:Orc5:Orc3:Orc2:origin [nucleoplasm] (REACT_2696).
REACTOME_PATHWAY: Cell Cycle Checkpoints (REACT_1538), Assembly of the ORC complex at the origin of replication (REACT_567), Association of licensing factors with the pre-replicative complex (REACT_77177), Switching of origins to a post-replicative state (REACT_2148), S Phase (REACT_82813), DNA Replication (REACT_383), Mitotic M-M/G1 phases (REACT_82114), Activation of the pre-replicative complex (REACT_1095), Assembly of the ORC complex at the origin of replication (REACT_87008), Removal of licensing factors from origins (REACT_90316), Orc1 removal from chromatin (REACT_1156), Activation of the pre-replicative complex (REACT_110126), Mitotic G1-G1/S phases (REACT_21267), Cell Cycle, Mitotic (REACT_152), G1/S Transition (REACT_1783), Removal of licensing factors from origins (REACT_207), Mitotic M-M/G1 phases (REACT_21300), Orc1 removal from chromatin (REACT_107429), DNA Replication Pre-Initiation (REACT_99126), M/G1 Transition (REACT_32146), CDK-mediated phosphorylation and removal of Cdc6 (REACT_1221), Cell Cycle, Mitotic (REACT_85950), Association of licensing factors with the pre-replicative complex (REACT_1181), CDC6 association with the ORC:origin complex (REACT_31806), Regulation of DNA replication (REACT_829), G2/M Checkpoints (REACT_828), DNA Replication Pre-Initiation (REACT_734), Synthesis of DNA (REACT_2014), Mitotic G1-G1/S phases (REACT_82281), G1/S Transition (REACT_102687), CDC6 association with the ORC:origin complex (REACT_1707), Switching of origins to a post-replicative state (REACT_110251), CDT1 association with the CDC6:ORC:origin complex (REACT_1949), M/G1 Transition (REACT_1725), Regulation of DNA replication (REACT_102039), Assembly of the pre-replicative complex (REACT_2243), DNA Replication (REACT_85544), S Phase (REACT_899), E2F mediated regulation of DNA replication (REACT_471), Assembly of the pre-replicative complex (REACT_88527), E2F-enabled inhibition of pre-replication complex formation (REACT_1321), Synthesis of DNA (REACT_98237), Activation of ATR in response to replication stress (REACT_6769).
These properties come from phylome analysis
molecular_function: methyltransferase activity, nucleoside-triphosphatase activity, zinc ion binding, ATP binding, protein binding, DNA binding.
cellular_component: nucleus, origin recognition complex.
biological_process: RNA capping, RNA methylation, DNA replication.
These properties come from kegg analysis
KEGG_ORTHOLOGS: origin recognition complex subunit 1 (K02603).
This polypeptide in other databases
In PhylomeDB is Phy003A249_CUCME .
