Polypeptide MELO3C007085P1
Accession: MELO3C007085P1
Name: MELO3C007085P1
Description: Similar to FACT complex subunit SPT16 (Arabidopsis thaliana) (uniprot_sprot:sp|O82491|SPT16_ARATH)
Sequence:
>MELO3C007085P1 Similar to FACT complex subunit SPT16 (Arabidopsis thaliana) (uniprot_sprot:sp|O82491|SPT16_ARATH) MADRRNGNSQPPSAKASGGGNTYDIDLVNFSTRLKSLYSHWGEHKSDMWSSSDVLTIGTPPASEDLRYLKSSALHIWLFG YEFPETVIVFTKKQIHFLCSQKKVSLLDVVKKPAFEAVGADVVMHVKAKNDDGSSLMDSIFRAIRAQSKADGMENPVVGY IAREAPEGKLLETWSGKLKSANFELVDITNGLSDLFACKDDTEIMNIKKAAFLTVNVMNKVVVPKMENVIDEEKKITHSS LMDETEKAILEPTKAGVKLKTENVDICYPPIFQSGGVFDLRPSAASNDELLHYDPASVIICAVGSRYKSYCSNIARTFLI DANTLQSKAYEVLLKAQEVAISMLRPRNKVNAAYTAALSVVKKESPELVPNLTKSAGTGIGLEFRESGLNLNAKNDRIVK AGMVFNVSLGFQNLTPTDKLQNSAGKTKNQNFSLLIADTVIVGKEKTEVLTAPSSKSFKDVAYSFNEDEEEEEKLKVKTE ANGKEAVVSKTTLRSDNHEISKEELRRQHQAELARQKNEETARRLAGVGNGAGDNRSSMRTAADLIAYKSVNDLPPQRDL MIYIDQKNETVLLPIYGSMVPFHVATIRTVSSQQDTNRTCYIRIIFNVPGTPFSPHDANSLKFQGSIYLKEVSFRSKDPR HISEVVQLIKTLRRQVVARESERAERATLVTQEKLQLAGNRFKPIRLPELWIRPAFGGRGRKLPGTLEAHLNGFRYATTR SEERVDIMFGNVKHAFFQPAENEMITLLHFHLHNHIMVGNKKTKDVQFYVEVMDVVQTIGGGKRSAYDPDEIEEEQRERD RKNKINMDFQSFVNRVNDLWGQPQFSGLDLEFDQPLRELGFHGVPYKSSAFIVPTSTCLVELIETPFLVVTLGEIEIVNL ERVGFGQKNFDMTIVFKDFKRDVLRIDSIPSTSLDGIKEWLDTTDIKYYESKLNLNWRQILKTITDEPQSFIDEGGWEFL NLEATDSESENSEESDKGYEPSDVEPESDSEEDDSDSASLVESEDEEEEDSDGDSEEEKGKTWEELEREASNADREKGDE SDSEEERKRRKMKTFGKFRAGPSGNAPKRPKMR*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: 2-4 nt.backtracking of Pol II complex on the template leading to elongation pausing (REACT_30549), Abortive termination of HIV-1 elongation after arrest (REACT_6352), Resumption of elongation of HIV-1 transcript after recovery from pausing (REACT_6155), Abortive termination of elongation after arrest (REACT_6355), Recruitment of elongation factors to form HIV-1 elongation complex (REACT_6275), Recruitment of elongation factors to form HIV-1 elongation complex (REACT_6358), Addition of nucleotides leads to HIV-1 transcript elongation (REACT_6278), 2-4 nt.backtracking of Pol II complex on the HIV-1 template leading to elongation pausing (REACT_6214), Pol II elongation complex moves on the HIV-1 template as transcript elongates (REACT_6158), Resumption of elongation after recovery from pausing (REACT_79713), Resumption of elongation after recovery from pausing (REACT_99936), TFIIS-mediated recovery of elongation from arrest (REACT_1094), Resumption of elongation after recovery from pausing (REACT_1638), Formation of FACT complex (REACT_89267), 7-14 nt. Backtracking of Pol II complex on the template leading to elongation arrest (REACT_1645), TFIIS-mediated recovery of elongation from arrest (REACT_6330), Formation of FACT complex (REACT_92447), Abortive termination of elongation after arrest (REACT_95584), Abortive termination of elongation after arrest (REACT_98053), Separation of elongating transcript from template (REACT_34213), 7-14 nt. Backtracking of Pol II complex on the HIV-1 template leading to elongation arrest (REACT_6174), Resumption of elongation of HIV-1 transcript after recovery from pausing (REACT_6299), 7-14 nt. Backtracking of Pol II complex on the HIV-1 template leading to elongation arrest (REACT_6254), Pol II elongation complex moves on the template as transcript elongates (REACT_30284), Separation of elongating transcript from template (REACT_81515), 2-4 nt.backtracking of Pol II complex on the template leading to elongation pausing (REACT_83561), TFIIS-mediated recovery of HIV-1 elongation from arrest (REACT_6252), Separation of elongating HIV-1 transcript from template (REACT_6204), Recruitment of elongation factors to form elongation complex (REACT_949), 2-4 nt.backtracking of Pol II complex on the HIV-1 template leading to elongation pausing (REACT_6347), Separation of elongating transcript from template (REACT_2030), Abortive termination of HIV-1 elongation after arrest (Tat-containing elongation complex) (REACT_6269), Addition of nucleotides leads to transcript elongation (REACT_751), Pol II elongation complex moves on the template as transcript elongates (REACT_2053), Formation of FACT complex (REACT_294), 2-4 nt.backtracking of Pol II complex on the template leading to elongation pausing (REACT_234), Elongating transcript encounters a lesion in the template (REACT_1138), TFIIS-mediated recovery of elongation from arrest (REACT_101748), Addition of nucleotides leads to transcript elongation (REACT_107064), TFIIS-mediated recovery of elongation from arrest (REACT_102520), Addition of nucleotides leads to transcript elongation (REACT_100466), Pol II elongation complex moves on the template as transcript elongates (REACT_30038).
biological_process: gene expression, viral transcription, positive regulation of viral transcription, viral reproduction, transcription elongation from RNA polymerase II promoter, transcription from RNA polymerase II promoter.
REACTOME_COMPLEX: Elongation complex [nucleoplasm] (REACT_3511), Elongation complex prior to separation [nucleoplasm] (REACT_5853), Elongation complex with separated and uncleaved transcript [nucleoplasm] (REACT_5512), HIV-1 elongation complex containing Tat [nucleoplasm] (REACT_6611), Tat-containing elongation complex prior to separation [nucleoplasm] (REACT_6548), HIV-1 Tat-containing arrested processive elongation complex [nucleoplasm] (REACT_6532), Processive elongation complex [nucleoplasm] (REACT_3018), HIV-1 aborted elongation complex after arrest [nucleoplasm] (REACT_6471), HIV-1 arrested processive elongation complex [nucleoplasm] (REACT_6609), Paused processive elongation complex [nucleoplasm] (REACT_3066), HIV-1 paused processive elongation complex [nucleoplasm] (REACT_6459), Arrested processive elongation complex [nucleoplasm] (REACT_4675), Aborted elongation complex after arrest [nucleoplasm] (REACT_6654), FACT complex [nucleoplasm] (REACT_4314), HIV-1 elongation complex [nucleoplasm] (REACT_6501), HIV-1 processive elongation complex [nucleoplasm] (REACT_6579), HIV-1 Tat-containing aborted elongation complex after arrest [nucleoplasm] (REACT_6602), P-TEFb(Cyclin T1:Cdk9)-containing elongation complex with separated and uncleaved transcript [nucleoplasm] (REACT_6686), HIV-1 Tat-containing processive elongation complex [nucleoplasm] (REACT_6452), HIV-1 Tat-containing paused processive elongation complex [nucleoplasm] (REACT_6389).
REACTOME_PATHWAY: HIV-1 Transcription Elongation (REACT_6274), Transcription of the HIV genome (REACT_6233), Formation and Maturation of mRNA Transcript (REACT_77979), Formation of RNA Pol II elongation complex (REACT_1845), Pausing and recovery of elongation (REACT_769), Transcription (REACT_100899), Transcription (REACT_1788), Pausing and recovery of elongation (REACT_111024), Pausing and recovery of elongation (REACT_83577), RNA Polymerase II Pre-transcription Events (REACT_91707), Gene Expression (REACT_71), Formation of HIV-1 elongation complex in the absence of HIV-1 Tat (REACT_22201), HIV-1 elongation arrest and recovery (REACT_6259), Elongation arrest and recovery (REACT_91132), RNA Polymerase II Transcription (REACT_1366), Elongation arrest and recovery (REACT_79615), RNA Polymerase II Transcription Elongation (REACT_833), HIV Life Cycle (REACT_6256), RNA Polymerase II Transcription Elongation (REACT_92836), Formation of HIV-1 elongation complex containing HIV-1 Tat (REACT_6346), Tat-mediated HIV-1 elongation arrest and recovery (REACT_6344), Pausing and recovery of Tat-mediated HIV-1 elongation (REACT_6143), RNA Polymerase II Transcription (REACT_106213), Formation and Maturation of mRNA Transcript (REACT_2039), Transcription (REACT_34268), RNA Polymerase II Pre-transcription Events (REACT_22107), Gene Expression (REACT_108313), Tat-mediated elongation of the HIV-1 transcript (REACT_6162), RNA Polymerase II Pre-transcription Events (REACT_82104), Elongation arrest and recovery (REACT_1892), HIV Infection (REACT_6185), RNA Polymerase II Transcription Elongation (REACT_87946), Gene Expression (REACT_105649), Formation and Maturation of mRNA Transcript (REACT_32779), Late Phase of HIV Life Cycle (REACT_6361), Pausing and recovery of HIV-1 elongation (REACT_6244), RNA Polymerase II Transcription (REACT_99228).
These properties come from phylome analysis
molecular_function: positive transcription elongation factor activity, GTP binding, protein binding.
cellular_component: FACT complex, replication fork protection complex, nuclear euchromatin, nucleoplasm, nucleus, nuclear chromatin, nucleolus, chromosome.
biological_process: positive regulation of transcription initiation from RNA polymerase II promoter, cell division, positive regulation of viral transcription, positive regulation of RNA polymerase II transcriptional preinitiation complex assembly, DNA replication-independent nucleosome organization, regulation of transcription by chromatin organization, molting cycle, collagen and cuticulin-based cuticle, viral reproduction, vegetative to reproductive phase transition of meristem, cellular process, embryo development ending in birth or egg hatching, nucleus organization, transcription elongation from RNA polymerase II promoter, transcription from RNA polymerase II promoter, transcription, DNA-dependent, nucleosome disassembly, nucleosome assembly, DNA-dependent DNA replication, gastrulation with mouth forming first, regulation of chromatin assembly or disassembly, cytokinesis, regulation of transcription, DNA-dependent, DNA repair, DNA replication.
These properties come from blast2go analysis
cellular_component: plastid, nucleolus, chromosome.
biological_process: regulation of transcription, DNA-dependent, DNA repair, DNA replication.
This polypeptide in other databases
In PhylomeDB is Phy003ADUE_CUCME .
