Polypeptide MELO3C007207P1

Accession: MELO3C007207P1

Name: MELO3C007207P1

Description: Similar to Shaggy-related protein kinase eta (Arabidopsis thaliana) (uniprot_sprot:sp|Q39011|KSG7_ARATH)

Sequence:

>MELO3C007207P1 Similar to Shaggy-related protein kinase eta (Arabidopsis thaliana) (uniprot_sprot:sp|Q39011|KSG7_ARATH)
MADDKEMSGPVIDGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFKAKCLETGENVAIKKVLQDRRYKNR
ELQLMRVMDHPNVISLKHCFFSTTTKDELFLNLVMEYVPETMFRVLKHYSNANQRMPIIYVKLYMYQVFRGLAYIHTVPG
VCHRDLKPQNILVDPLTHQVKICDFGSAKMLMKGEANVSYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPL
FPGENAVDQLVEIIKVLGTPTREEIRCMNPSYTDYRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACT
HPFFDELREPNARLPNGRPFPPLFNFKQELSGASPELVNKLIPDQVKRQMGLNLHLAVS*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: tau-protein kinase activity, identical protein binding, ATP binding, protein serine/threonine kinase activity.

biological_process: protein phosphorylation.

These properties come from reactome analysis


REACTOME_REACTION: Phosphoryation of phospho- (Ser45, Thr41) beta-catenin at Ser37 by GSK-3 (REACT_31296), Phosphorylation of beta-catenin at Ser45 by CK1 alpha (REACT_87470), Multi-ubiquitination of phospho-beta-catenin by SCF-beta-TrCP1 (REACT_101640), Phosphorylation of phospho-(Ser45 ) at Thr 41 by GSK-3 (REACT_31799), Association of beta-catenin with the SCF-beta-TrCP1 ubiquitin ligase complex (REACT_34050), AKT phosphorylates GSK3 (REACT_108360), Phosphorylation of phospho-(Ser45,Thr41,Ser37) at Ser33 by GSK-3 (REACT_109807), Phosphorylation of APC component of the destruction complex (REACT_90760), Dissociation of beta-catenin from Axin and association of beta catenin with phospho-(20 aa) APC in the detruction complex (REACT_87315).

REACTOME_PATHWAY: PI3K/AKT activation (REACT_97931), Beta-catenin phosphorylation cascade (REACT_102439), Signaling by Wnt (REACT_89971), Signaling by FGFR (REACT_103577), Degradation of beta-catenin by the destruction complex (REACT_89447), Signalling by NGF (REACT_82110), NGF signalling via TRKA from the plasma membrane (REACT_100895), PIP3 activates AKT signaling (REACT_106479), AKT phosphorylates targets in the cytosol (REACT_77637), PI-3K cascade (REACT_107804), Downstream signaling of activated FGFR (REACT_109146).

biological_process: fibroblast growth factor receptor signaling pathway, nerve growth factor receptor signaling pathway, phosphatidylinositol-mediated signaling.

These properties come from phylome analysis


molecular_function: tau-protein kinase activity, identical protein binding, ATP binding, protein serine/threonine kinase activity.

cellular_component: plasma membrane.

biological_process: positive regulation of protein export from nucleus, protein autophosphorylation, interspecies interaction between organisms, leaf morphogenesis, multidimensional cell growth, brassinosteroid mediated signaling pathway, response to auxin stimulus, detection of brassinosteroid stimulus, protein phosphorylation.

These properties come from kegg analysis


KEGG_ORTHOLOGS: protein brassinosteroid insensitive 2 [EC:2.7.11.1] (K14502).

Locations

Located in CM3.5_scaffold00007 from 1474789 to 1478938.

This polypeptide in other databases

In PhylomeDB is Phy003A18Y_CUCME .

Related features