Polypeptide MELO3C007373P1

Accession: MELO3C007373P1

Name: MELO3C007373P1

Description: Similar to Cysteine-rich PDZ-binding protein (Rattus norvegicus) (uniprot_sprot:sp|Q792Q4|CRIPT_RAT)

Sequence:

>MELO3C007373P1 Similar to Cysteine-rich PDZ-binding protein (Rattus norvegicus) (uniprot_sprot:sp|Q792Q4|CRIPT_RAT)
MVCEKCEKKLSKVIVPDKWKEGASNTQESGGRKINENKLLSKKKRWTPYGNTKCIICKQQVHQDGKYCHTCAYSKGVCAM
CGKQVLDTKFYKQSNV*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: protein domain specific binding.

cellular_component: postsynaptic membrane, cell projection.

These properties come from phylome analysis


molecular_function: protein binding.

cellular_component: dendritic spine, cell junction, cytoplasm.

biological_process: locomotion, positive regulation of growth rate, growth, embryo development ending in birth or egg hatching, nematode larval development, gastrulation with mouth forming first, reproduction.

Locations

Located in CM3.5_scaffold00007 from 2419317 to 2420479.

This polypeptide in other databases

In PhylomeDB is Phy003ABT0_CUCME .

Related features