Polypeptide MELO3C007520P2

Accession: MELO3C007520P2

Name: MELO3C007520P2

Description: Similar to Guanine nucleotide-binding protein alpha-1 subunit (Lotus japonicus) (uniprot_sprot:sp|P49082|GPA1_LOTJA)

Sequence:

>MELO3C007520P2 Similar to Guanine nucleotide-binding protein alpha-1 subunit (Lotus japonicus) (uniprot_sprot:sp|P49082|GPA1_LOTJA)
MPLVEAMVADPVDGIQYSFAKEYKGPPVPYDLPQALPINVERIPVAAVVAEVPFTHKMSLPVVQPILAQDVMSKKFSKEL
EPAVGKSVVSPTSVIAFDQSTEDSRRCLSKESDSGSERTVSPTSVIAFEDRVVGNHGCQLSGDLSSSAVTFLDPESDYTY
NEEYSQDGPETLRMRQDSLRKGKKGSCYRCGKGNRFTEKEVCIVCDAKYCSNCVLRAMGSMPEGRKCVTCIGFPIDESKR
GNLGKCPRMLKRLLNDLEIRQVMTAEKCCEANQLPPEYVCVNGEPLSFEELSMLQTCPNPPKKLKPGNYWYDKVSGLWGK
EGQKPSKIITPHLNIGGPIKADASNGNTKIFINGREITKVELRMLQLAGVQCAGNPHFWVNEDGSYQEEGQKNTKGYIWG
KAGTKLVCALLSLPVPSKSSNYSGEPDSSLVYRTFPEYLGLQKLLLVGYDGSGTSTIFKQAKILYKDAPFSKEEREIIKL
KIQSNVYGYLGIILEGRERFEEDSSAEIRKKLSDEVDPAGSSSVDSDKSMYSIGPRLKAFSDWLLKTMVSGTLETIFPAA
TREYAPLVEELWNDAAIQATYKRGSELEMLPNVAHYFLERVVDILTTDYEPSDSDILYAEGLISSNGLACVDFSFPQPAP
DDDIDTADQHSSLLRYQLIRAHARGIGENCKWLEMFEDIGIVIFCVSLSDYDQFSIDGNGDTVNKMLLSRKFFESLVTHP
TFYQMDFLVLLNKYDQFEEKVERVPLTRCEWFNDFHPMISRNRSNSQNNINSSPSLGQLGFHYIAVKFKRLFTSLTGRKL
YVSPVKGLEPHSVDAALKYAREIMKWDEERTNFSLSEYSVYSTEESSFSH*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_PATHWAY: Synaptic Transmission (REACT_29595), G-protein activation (REACT_85866), Regulation of Insulin Secretion (REACT_18325), Inhibition of adenylate cyclase pathway (REACT_25282), Regulation of Water Balance by Renal Aquaporins (REACT_99705), G alpha (i) signalling events (REACT_87312), Opioid Signalling (REACT_32504), Platelet Activation (REACT_798), Adenylate cyclase inhibitory pathway (REACT_104417), Neuroransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell (REACT_92810), PKA activation in glucagon signalling (REACT_109694), Synaptic Transmission (REACT_13685), GABA receptor activation (REACT_32964), GPCR downstream signaling (REACT_81307), Thromboxane signalling through TP receptor (REACT_32234), GABA B receptor activation (REACT_37805), G alpha (12/13) signalling events (REACT_107383), PKA activation in glucagon signalling (REACT_80338), G alpha (12/13) signalling events (REACT_18407), Regulation of Insulin Secretion by Acetylcholine (REACT_18405), Transmission across Chemical Synapses (REACT_13477), G alpha (q) signalling events (REACT_78862), PLC beta mediated events (REACT_15426), Signaling by GPCR (REACT_83331), PLC beta mediated events (REACT_30626), Signal amplification (REACT_107520), Signaling by GPCR (REACT_14797), Neuroransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell (REACT_15370), Formation of Platelet plug (REACT_20), Activation of GABAB receptors (REACT_87363), GPCR downstream signaling (REACT_90453), Prostacyclin signalling through prostacyclin receptor (REACT_90454), Transmembrane transport of small molecules (REACT_86409), Platelet activation triggers (REACT_78872), G-protein activation (REACT_83156), Integration of energy metabolism (REACT_31409), Regulation of Insulin Secretion by Free Fatty Acids (REACT_19375), GABA receptor activation (REACT_25199), G-protein activation (REACT_85891), Olfactory Signaling Pathway (REACT_15488), GABA B receptor activation (REACT_25031), GPCR downstream signaling (REACT_19184), Signaling by GPCR (REACT_81368), GPCR downstream signaling (REACT_89233), G alpha (s) signalling events (REACT_105431), G-protein mediated events (REACT_81829), Opioid Signalling (REACT_15295), Formation of Platelet plug (REACT_104262), Activation of GABAB receptors (REACT_25330), Platelet activation triggers (REACT_622), Integration of energy metabolism (REACT_89538), G alpha (s) signalling events (REACT_81642), Adenylate cyclase activating pathway (REACT_79509), Regulation of Insulin Secretion by Fatty Acids Bound to GPR40 (FFAR1) (REACT_19193), Signal amplification (REACT_20524), Opioid Signalling (REACT_106868), Integration of energy metabolism (REACT_1505), Glucagon signaling in metabolic regulation (REACT_83177), Inhibition of adenylate cyclase pathway (REACT_29125), G alpha (z) signalling events (REACT_29998), G alpha (q) signalling events (REACT_94531), Adenylate cyclase activating pathway (REACT_99513), Aquaporin-mediated transport (REACT_32279), Platelet Activation (REACT_88667), Transmission across Chemical Synapses (REACT_105301), G alpha (q) signalling events (REACT_18283), G alpha (z) signalling events (REACT_101356), G alpha (i) signalling events (REACT_82176), Adenylate cyclase inhibitory pathway (REACT_15333), Hemostasis (REACT_604), Regulation of Water Balance by Renal Aquaporins (REACT_107038), Opioid Signalling (REACT_106208), Signaling by GPCR (REACT_92902), Platelet homeostasis (REACT_81787), Glucagon signaling in metabolic regulation (REACT_97918), G alpha (i) signalling events (REACT_19231), Diabetes pathways (REACT_15380), Hemostasis (REACT_92318), PLC beta mediated events (REACT_80001), Transmembrane transport of small molecules (REACT_102897), G-protein activation (REACT_15457), G alpha (z) signalling events (REACT_19333), Aquaporin-mediated transport (REACT_83369), Inhibition of Insulin Secretion by Adrenaline/Noradrenaline (REACT_18339), Thromboxane signalling through TP receptor (REACT_20647), G-protein mediated events (REACT_99045), G-protein mediated events (REACT_15526), G alpha (12/13) signalling events (REACT_85741), G alpha (z) signalling events (REACT_91871), ADP signalling through P2Y purinoceptor 12 (REACT_20653), Adenylate cyclase activating pathway (REACT_15312), Thrombin signalling through proteinase activated receptors (PARs) (REACT_21384), ADP signalling through P2Y purinoceptor 1 (REACT_19140).

REACTOME_REACTION: G alpha (12/13) auto-inactivates by hydrolysing GTP to GDP (REACT_78069), p115-RhoGEF activation of Rac1 (REACT_33674), G alpha (z) auto-inactivates by hydrolysing GTP to GDP (REACT_82856), G13 activation by TP receptor (REACT_20567), Liganded Gi-activating GPCR acts as a GEF for Gi (REACT_15538), G alpha-olf:GTP binds to Gi alpha1:GTP:adenylate cyclase complex (REACT_15435), p115-RhoGEF activation of Rac1 (REACT_1214), Thrombin-activated PAR binds G-protein G12/13 (REACT_23839), Adenylate cyclase converts ATP into cyclic AMP (REACT_104211), LARG activation by G alpha 12/13 (REACT_19158), GRK5 sequesters activated Gq (REACT_100374), GRK2 sequesters activated Gq (REACT_19213), Liganded Gz-activating GPCRs bind inactive heterotrimeric G-protein Gz (REACT_22150), Adenylaye cyclase increases the GTPase activity of G alpha-olf (REACT_108825), Activation of Gi/o Heterotrimeric G Proteins by Alpha Adrenergic Receptors Alpha-2A/2C (REACT_18311), Dissociation of Gq alpha:GTP Complex from G beta:G gamma Complex (REACT_18316), Opsins that act as GEFs for G alpha-t (REACT_18400), G alpha-olf:GTP binds to Gi alpha1:GTP:adenylate cyclase complex (REACT_105297), Inactivation of PLC beta (REACT_87892), The receptor:G-protein complex releases GDP (REACT_15549), The G alpha-olf:GDP:Adenylate cyclase complex dissociates (REACT_15547), LARG binds plexin B1 (REACT_19360), Activated Adenylate cyclase catalyses cAMP synthesis (REACT_30354), G alpha (z) auto-inactivates by hydrolysing GTP to GDP (REACT_95550), Inactive G alpha (12/13) reassociates with G beta:gamma (REACT_22368), G-protein alpha subunit is inactivated (REACT_83403), Liganded Gi-activating GPCR acts as a GEF for Gi (REACT_34343), Liganded G12/13-activating GPCR acts as a GEF for G12/13 (REACT_22370), G alpha (q) auto-inactivates by hydrolysing GTP to GDP (REACT_81664), G alpha (q) inhibits PI3K alpha (REACT_19172), Activated TP receptor binds G-protein G13 (REACT_20501), G alpha (z) auto-inactivates by hydrolysing GTP to GDP (REACT_19178), Gi activation by P2Y purinoceptor 12 (REACT_20507), Activation of Phospholipase C Beta by Gq alpha (REACT_18418), PLC beta is activated by G alpha (q) (REACT_19270), Activation of Gq by Muscarinic Acetylcholine Receptor M3 (REACT_18309), G Protein trimer formation (olfactory) (REACT_15416), G12/13 activation by PAR (REACT_637), The receptor:G-protein complex dissociates (REACT_15336), Adenylate cyclase increases the GTPase activity of Gi alpha (REACT_15495), PLC beta-mediated PIP2 hydrolysis (REACT_960), The receptor:G-protein complex binds GTP (REACT_15491), G alpha (q) binds to Trio family RhoGEFs (REACT_91138), PIP2 hydrolysis (REACT_15353), G alpha (z) inhibits adenylate cyclase (REACT_88242), Gq activation by TP receptor (REACT_20511), G alpha (q) auto-inactivates by hydrolysing GTP to GDP (REACT_19186), PIP2 hydrolysis (REACT_104013), Liganded Gq/11-activating GPCRs act as GEFs for Gq/11 (REACT_15291), G-protein alpha subunit is inactivated (REACT_34480), G alpha (s) activates adenylate cyclase (REACT_95192), Adenylate cyclase increases the GTPase activity of Gi alpha (REACT_84312), The high affinity receptor complex binds to G-protein (REACT_15298), Adenylate cyclase converts ATP into cyclic AMP (REACT_110346), Dissociation of the PAR:G12/13 complex (REACT_23796), Activation of PLC beta-1/4 (REACT_15402), Liganded Gz-activating GPCR acts as a GEF for Gz (REACT_22380), Adenylaye cyclase increases the GTPase activity of G alpha-olf (REACT_31530), Liganded Gi-activating GPCRs bind inactive heterotrimeric G-protein Gi (REACT_22289), GRK2 sequesters activated Gq (REACT_84415), Activation of Gq by Fatty Acid Receptor 1: Fatty Acid Complex (REACT_19346), Inactive G alpha (z) reassociates with G beta:gamma (REACT_22135), The Ligand:GPCR:Gq complex dissociates (REACT_22263), The Ligand:GPCR:G12/13 complex dissociates (REACT_22264), Gs activation by prostacyclin receptor (REACT_110192), G alpha (i) auto-inactivates by hydrolysing GTP to GDP (REACT_19219), Gq activation by P2Y purinoceptor 1 (REACT_20636), LARG activation by G alpha 12/13 (REACT_29492), G alpha (q) binds to Trio family RhoGEFs (REACT_86116), Dissociation of the P2Y purinoceptor 12:Gi complex (REACT_20630), Activated P2Y purinoceptor 1 binds G-protein Gq (REACT_20525), Activated P2Y purinoceptor 12 binds G-protein Gi (REACT_20523), Activated TP receptor binds G-proten Gq (REACT_20520), Thrombin-activated PAR binds G-protein Gq (REACT_23902), Gq activation by TP receptor (REACT_100888), G alpha (s) auto-inactivates by hydrolysing GTP to GDP (REACT_110859), Liganded Gz-activating GPCR acts as a GEF for Gz (REACT_33310), PLC beta-mediated PIP2 hydrolysis (REACT_28636), G alpha (s) auto-inactivates by hydrolysing GTP to GDP (REACT_101520), PLC beta is activated by G alpha (q) (REACT_81799), Gz is a substrate for PKC (REACT_22249), G alpha (z) auto-inactivates by hydrolysing GTP to GDP (REACT_107730), PLC beta is activated by G alpha (q) (REACT_97105), Gq activation by PAR (REACT_1430), G alpha (13) activates Rho guanine nucleotide exchange factor 1 (p115-RhoGEF) (REACT_32496), PIP2 hydrolysis (REACT_87628), The G alpha-olf:GDP:Adenylate cyclase complex dissociates (REACT_108770), G alpha (12/13) auto-inactivates by hydrolysing GTP to GDP (REACT_96132), PLC beta-mediated PIP2 hydrolysis (REACT_80473), G alpha (s) activates adenylate cyclase (REACT_34695), G alpha (12/13) auto-inactivates by hydrolysing GTP to GDP (REACT_19123), Adenylate cyclase increases the GTPase activity of G alpha-olf (REACT_15335), GRK5 sequesters activated Gq (REACT_19325), G13 activation by TP receptor (REACT_79051), Dissociation of Gi/o Heterotrimeric G-protein Complex (REACT_18349), Dissociation of the TP:Gq complex (REACT_20658), Activation of PLC beta-1/4 (REACT_98277), G-protein beta-gamma subunits rebind the alpha-GDP subunit (REACT_15387), Inactive G alpha (i) reassociates with G beta:gamma (REACT_22335), Galpha-olf:GTP binds to adenylate cyclase and activates it (REACT_15385), Dissociation of the Gi alpha:G olf complex (REACT_15384), The Ligand:GPCR:Gi complex dissociates (REACT_22239), Liganded Gz-activating GPCR acts as a GEF for Gz (REACT_83698), Hydrolysis of 1-Phosphatidyl-D-myo-inositol 4,5-bisphosphate by Activated Phospholipase C Beta-1 (REACT_18383), LARG activation by G alpha 12/13 (REACT_109073), Dissociation of the Gi alpha:G olf complex (REACT_107224), Inactivation of PLC beta (REACT_31813), Olfactory Receptor - G Protein olfactory trimer complex formation (REACT_15515), Activated Adenylate cyclase catalyses cAMP synthesis (REACT_80465), G-protein alpha subunit is inactivated (REACT_31604), G alpha (q) inhibits PI3K alpha (REACT_95725), Inactivation of PLC beta (REACT_15301), Liganded Gq-activating GPCRs bind inactive heterotrimeric Gq (REACT_22436), Adenylate cyclase increases the GTPase activity of G alpha-olf (REACT_30005), G alpha (q) binds to Trio family RhoGEFs (REACT_19301), Liganded G12/13-activating GPCRs bind inactive heterotrimeric G-protein G12/13 (REACT_22424), Inactive G alpha (q) reassociates with G beta:gamma (REACT_22425), Dissociation of the PAR:Gq complex (REACT_23818), Galpha-olf:GTP binds to adenylate cyclase and activates it (REACT_106393), Galpha-olf:GTP binds to adenylate cyclase and activates it (REACT_80878), G alpha (13) activates Rho guanine nucleotide exchange factor 1 (p115-RhoGEF) (REACT_56), G alpha (i) inhibits adenylate cyclase (REACT_19222), GRK5 sequesters activated Gq (REACT_84764), G alpha (z) inhibits adenylate cyclase (REACT_93015), Dissociation of the P2Y purinoceptor 1:Gq complex (REACT_20551), Adenylate cyclase converts ATP into cyclic AMP (REACT_15399), The G alpha-olf:GDP:Adenylate cyclase complex dissociates (REACT_78239), Dissociation of the TP:G13 complex (REACT_20559), Activation of PLC beta-1/4 (REACT_91086), G-protein alpha subunit is inactivated (REACT_15316), G alpha (q) auto-inactivates by hydrolysing GTP to GDP (REACT_108363), G alpha (13) activates Rho guanine nucleotide exchange factor 1 (p115-RhoGEF) (REACT_82461), G alpha (z) inhibits adenylate cyclase (REACT_19147), Adenylaye cyclase increases the GTPase activity of G alpha-olf (REACT_15449), The Ligand:GPCR:Gz complex dissociates (REACT_22170).

REACTOME_COMPLEX: G alpha-olf:GTP:Adenylate cyclase (active) complex [plasma membrane] (REACT_17212), TP receptor:Thromboxane A2:G-protein G13 (active) [plasma membrane] (REACT_20781), G-protein alpha i/o:GDP Complex [plasma membrane] (REACT_18857), (Gi alpha1:GTP:Adenylate cyclase):(G alpha-olf:GDP) [plasma membrane] (REACT_15853), G-protein alpha i/o:GTP Complex [plasma membrane] (REACT_18504), Heterotrimeric G-protein Gi (inactive) [plasma membrane] (REACT_20935), G alpha-olf:GDP:Adenylate cyclase (active) complex [plasma membrane] (REACT_15796), Heterotrimeric G-protein Gi (active) [plasma membrane] (REACT_20744), Opioid:MOR:G protein-GTP complex [plasma membrane] (REACT_15831), G-alpha(t)-GDP:G-beta-gamma [plasma membrane] (REACT_18859), G(q):GDP: G beta: G gamma Complex (pancreatic beta cell) [plasma membrane] (REACT_18540), G protein-GDP complex [plasma membrane] (REACT_15793), G-protein alpha (12/13):LARG [plasma membrane] (REACT_19624), G-protein alpha (z):GTP [plasma membrane] (REACT_20258), Heterotrimeric G-protein G13 (active) [plasma membrane] (REACT_17395), Opioid:MOR:G protein-GDP complex [plasma membrane] (REACT_15815), Heterotrimeric G-protein Gz (inactive) [plasma membrane] (REACT_22728), G(q) alpha: GDP Complex (pancreatic beta cell) [plasma membrane] (REACT_23125), Ligand:GPCR complexes that activate Gq/11:Heterotrimeric G-protein Gq (inactive) [plasma membrane] (REACT_22865), G-protein alpha (12):GDP [plasma membrane] (REACT_2575), TP receptor:Thromboxane A2:G-protein G13 (inactive) [plasma membrane] (REACT_20823), Heterotrimeric G-protein [plasma membrane] (REACT_17846), Thrombin activated PAR:G12/13 (inactive) [plasma membrane] (REACT_18059), G-protein alpha (12/13):LARG:Plexin B1 [plasma membrane] (REACT_19937), Heterotrimeric G-protein Gq (active) [plasma membrane] (REACT_5824), G-protein alpha (13):GTP [plasma membrane] (REACT_18118), p(S27)-G protein alpha (z):GTP [plasma membrane] (REACT_22530), G-protein alpha (z):GTP:Adenylate cyclase [plasma membrane] (REACT_19687), G alpha-olf:GDP complex [plasma membrane] (REACT_17352), G-alpha(t)-GDP [plasma membrane] (REACT_18975), Heterotrimeric G-protein G13 (inactive) [plasma membrane] (REACT_17830), OR - G Protein Trimer Complex [plasma membrane] (REACT_17238), G13-activated p115-RhoGEF [plasma membrane] (REACT_3301), G-protein alpha (q/11): GTP [plasma membrane] (REACT_5863), Ligand:GPCR complexes that activate Gz:Heterotrimeric G-protein Gz (inactive) [plasma membrane] (REACT_23143), Gustducin Complex (alpha, beta, gamma subunits) [plasma membrane] (REACT_24604), Thrombin-activated PAR:Gq (active) [plasma membrane] (REACT_17562), G-protein alpha (q):GRK5 [plasma membrane] (REACT_19592), G-protein alpha (q/11):Trio family RhoGEFs [plasma membrane] (REACT_19870), Heterotrimeric G-protein Gz (active) [plasma membrane] (REACT_23379), Ligand:GPCR complexes that activate Gz:Heterotrimeric G-protein Gz (active) [plasma membrane] (REACT_22976), ADP:P2Y prurinoceptor 1:G-protein Gq (active) [plasma membrane] (REACT_20825), Thrombin-activated PAR:Gq (inactive) [plasma membrane] (REACT_17676), Thrombin activated PAR:G12/13 (active) [plasma membrane] (REACT_17549), G protein alpha:GDP complex [plasma membrane] (REACT_17462), G(q) alpha:GTP: G beta: G gamma Complex (pancreatic beta cell) [plasma membrane] (REACT_18484), Ligand:GPCR complexes that activate G12/13:Heterotrimeric G-protein G12/13 (inactive). [plasma membrane] (REACT_23035), Heterotrimeric G-protein G12 (active) [plasma membrane] (REACT_5245), G-protein alpha (13):GDP [plasma membrane] (REACT_17165), ADP:P2Y purinoceptor 12:G-protein Gi (inactive) [plasma membrane] (REACT_21024), G-protein alpha (q/11):GDP [plasma membrane] (REACT_3769), Phospholipase C Beta: G(q) Complex [plasma membrane] (REACT_18449), G-protein i/o alpha:GDP:G-protein beta:G-protein gamma Complex [plasma membrane] (REACT_18744), G-protein alpha (q/11):PI3K alpha [plasma membrane] (REACT_20202), G-alpha(t)-GTP [plasma membrane] (REACT_18710), G protein alpha:GTP complex [plasma membrane] (REACT_17389), G-protein alpha (i):GTP:Adenylate cyclase [plasma membrane] (REACT_19914), G-protein i/o alpha:GTP:G-protein beta:G-protein gamma Complex [plasma membrane] (REACT_18596), (Gi alpha1:GTP:Adenylate cyclase):(G alpha-olf:GTP) [plasma membrane] (REACT_15996), G(q) alpha: GTP Complex (pancreatic beta cell) [plasma membrane] (REACT_18564), G protein-GTP [plasma membrane] (REACT_15745), G alpha-olf:GTP [plasma membrane] (REACT_16015), G-protein alpha (i):GDP [plasma membrane] (REACT_19806), Ligand:GPCR complexes that activate Gi:Heterotrimeric G-protein Gi (inactive) [plasma membrane] (REACT_22813), G-protein alpha (12):GTP [plasma membrane] (REACT_5043), Heterotrimeric G-protein Gq/11 (inactive) [plasma membrane] (REACT_5130), G Protein Trimer Complex (olfactory) [plasma membrane] (REACT_15768), Ligand:GPCR complexes that activate G12/13:Heterotrimeric G-protein G12/13 (active). [plasma membrane] (REACT_22602), G-protein alpha (z):GDP [plasma membrane] (REACT_20097), (Gi alpha1:GDP:Adenylate cyclase):(G alpha-olf:GDP) [plasma membrane] (REACT_15896), TP receptor:Thromboxane A2:G-protein Gq (inactive) [plasma membrane] (REACT_20867), Ligand:GPCR complexes that activate Gi:Heterotrimeric G-protein Gi (active) [plasma membrane] (REACT_23190), PLC beta:G alpha (q/11) [plasma membrane] (REACT_17363), Ligand:GPCR complexes that activate Gq/11:Heterotrimeric G-protein Gq (active) [plasma membrane] (REACT_22589), G-protein alpha:GDP [plasma membrane] (REACT_17952), Heterotrimeric G-protein G12 (inactive) [plasma membrane] (REACT_5832), ADP:P2Y purinoceptor 12:G-protein Gi (active) [plasma membrane] (REACT_20967), G-protein alpha (q):GRK2 [plasma membrane] (REACT_19587), Activated PLC beta 1/4 [plasma membrane] (REACT_15568), Opioid:MOR:G-protein complex [plasma membrane] (REACT_15585), G-protein alpha (i): GTP [plasma membrane] (REACT_19580), ADP:P2Y purinoceptor 1:G-protein Gq (inactive) [plasma membrane] (REACT_21114), TP receptor:Thromboxane A2:G-protein Gq (active) [plasma membrane] (REACT_20944).

biological_process: activation of adenylate cyclase activity by G-protein signaling pathway, platelet activation, blood coagulation, water transport, energy reserve metabolic process, regulation of insulin secretion, inhibition of adenylate cyclase activity by G-protein signaling pathway, cellular response to glucagon stimulus, transmembrane transport, synaptic transmission.

These properties come from phylome analysis


molecular_function: signal transducer activity, GTP binding.

cellular_component: nucleus.

biological_process: G-protein coupled receptor protein signaling pathway, response to abscisic acid stimulus, response to sucrose stimulus, response to glucose stimulus, response to fructose stimulus, response to mannitol stimulus, regulation of root morphogenesis.

These properties come from blast2go analysis


molecular_function: signal transducer activity, guanyl nucleotide binding.

biological_process: signal transduction, G-protein coupled receptor protein signaling pathway.

Locations

Located in CM3.5_scaffold00007 from 3334546 to 3339223.

This polypeptide in other databases

In PhylomeDB is Phy003MAV0_CUCME .

Related features