Polypeptide MELO3C007668P1

Accession: MELO3C007668P1

Name: MELO3C007668P1

Description: Similar to Cysteine desulfurase 1, mitochondrial (Arabidopsis thaliana) (uniprot_sprot:sp|O49543|NFS1_ARATH)

Sequence:

>MELO3C007668P1 Similar to Cysteine desulfurase 1, mitochondrial (Arabidopsis thaliana) (uniprot_sprot:sp|O49543|NFS1_ARATH)
MASKILASCLRRTLTNSSPPISRFRPISTAAAVAASPSEPHEDETGISMKGVKISGRPLYLDMQATSPVDPRVLDAMLPY
YISRYGNPHSRTHLYGWESDHAVETARSQVAALIGASPKEIVFTSGATESNNISIKGVMHFYREKKRHLITTQTEHKCVL
DSCRHLQQEGFEITYLPVGSDGIVDLEKLRSAIRPDTGLVSVMAVNNEIGVIQPVEEIGKICKEFNVPFHTDAAQALGKI
PIDVEKWNVSLMSLSGHKIYGPKGIGALYMRRRPRIRVEPQMNGGGQERGIRSGTVPTPLVVGMGAACELAMKEMEYDDK
RITALQERLLNGINAKLEGVVVNGSMEKRYPGNLNLSFAYVEGESLLMGLKDVAVSSGSACTSASLEPSYVLRALGVDED
MAHTSIRFGIGRFTTEAEIDRAVELTVHQVEKLREMSPLYEMVKEGINIKEIQWAQH*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: protein homodimerization activity, cysteine desulfurase activity, pyridoxal phosphate binding.

cellular_component: cytosol, mitochondrial matrix, nucleus.

biological_process: iron incorporation into metallo-sulfur cluster, cysteine metabolic process.

These properties come from reactome analysis


REACTOME_REACTION: NFS1 transfers sulfur from cysteine onto MOCS3 (REACT_24937).

biological_process: molybdopterin cofactor biosynthetic process, vitamin metabolic process, water-soluble vitamin metabolic process.

REACTOME_COMPLEX: NFS1 holoenzyme [cytosol] (REACT_26174).

REACTOME_PATHWAY: Metabolism of water-soluble vitamins and cofactors (REACT_11238), Molybdenum cofactor biosynthesis (REACT_25073), Metabolism of vitamins and cofactors (REACT_11193).

These properties come from phylome analysis


molecular_function: identical protein binding, protein homodimerization activity, cysteine desulfurase activity, pyridoxal phosphate binding.

cellular_component: microtubule associated complex, mitochondrion, cytosol, mitochondrial matrix, nucleus.

biological_process: growth, tRNA thio-modification, iron-sulfur cluster assembly, embryo development ending in birth or egg hatching, cellular iron ion homeostasis, Mo-molybdopterin cofactor biosynthetic process, water-soluble vitamin metabolic process, protein complex assembly, nematode larval development, tRNA wobble uridine modification, reproduction, iron incorporation into metallo-sulfur cluster, cysteine metabolic process.

These properties come from kegg analysis


KEGG_REACTION: L-cysteine:[ThiI] (R07460).

KEGG_ORTHOLOGS: cysteine desulfurase [EC:2.8.1.7] (K04487).

molecular_function: cysteine desulfurase activity.

COG: Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes (COG1104).

KEGG_PATHWAY: Sulfur relay system (ko04122).

Locations

Located in CM3.5_scaffold00007 from 4542361 to 4543734.

This polypeptide in other databases

In PhylomeDB is Phy003LM4B_CUCME .

Related features