Polypeptide MELO3C007879P1
Accession: MELO3C007879P1
Name: MELO3C007879P1
Description: Similar to Glutaredoxin-C3 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FVX1|GRXC3_ARATH)
Sequence:
>MELO3C007879P1 Similar to Glutaredoxin-C3 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FVX1|GRXC3_ARATH) MMMRGFHFQLTLVVAVITLAALYPRDGLPGAEAATSTSAFVHNVIYSNRIAMFSKSYCPYCLGAKRIFSELHEKPFVVEL DLRDDGPQIQSVLLDLTGKRTVPQIFVNGKHIGGSDDLKAAVASGQLQKLLAST*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: protein disulfide oxidoreductase activity, electron carrier activity.
cellular_component: cytoplasmic membrane-bounded vesicle.
biological_process: cell redox homeostasis.
These properties come from reactome analysis
REACTOME_REACTION: glutaredoxin (oxidized) + glutathione (reduced) => glutaredoxin (reduced) + glutathione (oxidized) (REACT_1461), NDP + reduced glutaredoxin => dNDP + oxidized glutaredoxin + H2O (REACT_375), glutaredoxin (oxidized) + glutathione (reduced) => glutaredoxin (reduced) + glutathione (oxidized) (REACT_106063), NDP + reduced glutaredoxin => dNDP + oxidized glutaredoxin + H2O (REACT_110451), glutaredoxin (oxidized) + glutathione (reduced) => glutaredoxin (reduced) + glutathione (oxidized) (REACT_106153), NDP + reduced glutaredoxin => dNDP + oxidized glutaredoxin + H2O (REACT_31147).
REACTOME_PATHWAY: Synthesis and interconversion of nucleotide di- and triphosphates (REACT_109014), Metabolism of nucleotides (REACT_82673), Metabolism of nucleotides (REACT_29767), Synthesis and interconversion of nucleotide di- and triphosphates (REACT_29794), Synthesis and interconversion of nucleotide di- and triphosphates (REACT_21330), Metabolism of nucleotides (REACT_1698).
biological_process: nucleobase, nucleoside and nucleotide metabolic process, nucleobase, nucleoside and nucleotide interconversion.
These properties come from phylome analysis
molecular_function: 2 iron, 2 sulfur cluster binding, metal ion binding, protein disulfide oxidoreductase activity, electron carrier activity.
cellular_component: cytoplasm.
biological_process: electron transport chain, transport, cell redox homeostasis.
These properties come from kegg analysis
KEGG_ORTHOLOGS: glutaredoxin 3 (K03676).
COG: Glutaredoxin and related proteins (COG0695).
This polypeptide in other databases
In PhylomeDB is Phy003MBQL_CUCME .
