Polypeptide MELO3C008059P1

Accession: MELO3C008059P1

Name: MELO3C008059P1

Description: Similar to Whole genome shotgun sequence of line PN40024, scaffold_44.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7U4E0)

Sequence:

>MELO3C008059P1 Similar to Whole genome shotgun sequence of line PN40024, scaffold_44.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7U4E0)
MVFSASLSHNSFSCLTQFPQNFRRNPLRVHLIRAVKSTEPEKKVPETKTQEPPVAEPSSSSSPTASPKVPKKPVYSMKKG
QIVRVDKEKYLNSVNYLSVGHPPYFKGLDYIYEDRGEVLDLRIFETGEYALIAWVGIPTAPAWLPTEMLIKSEKLNYERL
*

Download fasta sequence.

Properties

These properties come from blast2go analysis


cellular_component: chloroplast, mitochondrion.

These properties come from phylome analysis


molecular_function: oxidoreductase activity, acting on NADH or NADPH, quinone or similar compound as acceptor.

cellular_component: NAD(P)H dehydrogenase complex (plastoquinone), chloroplast thylakoid membrane, plasma membrane.

biological_process: oxidation-reduction process, NADH dehydrogenase complex (plastoquinone) assembly.

Locations

Located in CM3.5_scaffold00007 from 7302067 to 7306399.

This polypeptide in other databases

In PhylomeDB is Phy003A57K_CUCME .

Related features