Polypeptide MELO3C011795P1

Accession: MELO3C011795P1

Name: MELO3C011795P1

Description: Similar to Protein ELC (Arabidopsis thaliana) (uniprot_sprot:sp|Q9LHG8|ELC_ARATH)

Sequence:

>MELO3C011795P1 Similar to Protein ELC (Arabidopsis thaliana) (uniprot_sprot:sp|Q9LHG8|ELC_ARATH)
MVPSPSHSDPSPPNPQIIQQFLSSVLSQRGPSALPYSEDTKWLIRQHLVALTTAFPSLVPRTASFTHNDGRSVNLLQSDG
TVPMSFQGVTYNIPVVIWLMESYPRHPPCVYVNPTRDMIIKRPHPHVNPSGMVSIPYLQNWIYPSSNLVELVRNLSVMFG
RDPPLYSQRRPNPSPSPSPSPSPSPSSSFGRNSVNSSIASNMGVAAFPRPAIPPRAYPPSPYGSGNDIASIARMQPHTED
PNEVFKRNAINKLVEMVHNDIVGLRKTREAEMEGLFSAQGVLRQREEDLNKGLKEMQDEKEALEQQLQMVLMNSDVLEAW
LRENEGKISSDFNADDAFECVDVLSKQVLECTASDLAIEDAIYSLDKAVQDGAIQFDQYLRNVRLLSREQFFHRATAAKV
RASQLQAQVANMASRISQYSNG*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: small conjugating protein ligase activity.

biological_process: regulation of protein metabolic process, post-translational protein modification, protein transport.

These properties come from reactome analysis


biological_process: endosome transport, cellular membrane organization.

REACTOME_REACTION: Cargo Recognition And Sorting (REACT_27272), Cargo Sequestration (REACT_27319).

REACTOME_COMPLEX: ESCRT-I [endosome membrane] (REACT_27580), ESCRT-I/Cargo Complex [endosome membrane] (REACT_27922).

REACTOME_PATHWAY: Membrane Trafficking (REACT_11123), Endosomal Sorting Complex Required For Transport (ESCRT) (REACT_27258).

These properties come from phylome analysis


molecular_function: calcium-dependent protein binding, ubiquitin binding, ubiquitin protein ligase binding, protein binding, transcription corepressor activity, DNA binding, small conjugating protein ligase activity.

cellular_component: late endosome membrane, endosome membrane, plasma membrane, multivesicular body, early endosome, nucleolus.

biological_process: cell division, non-lytic virus budding, negative regulation of imaginal disc growth, interspecies interaction between organisms, negative regulation of growth of symbiont in host, ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway, maintenance of apical/basal cell polarity, receptor catabolic process, endosome to lysosome transport via multivesicular body sorting pathway, protein catabolic process, endosome transport, cellular membrane organization, embryo development ending in birth or egg hatching, receptor-mediated endocytosis, protein modification process, nematode larval development, regulation of protein metabolic process, post-translational protein modification, protein transport.

These properties come from kegg analysis


KEGG_ORTHOLOGS: ESCRT-I complex subunit TSG101 (K12183).

Locations

Located in CM3.5_scaffold00016 from 892229 to 893497.

This polypeptide in other databases

In PhylomeDB is Phy003AAFA_CUCME .

Related features