Polypeptide MELO3C011830P1

Accession: MELO3C011830P1

Name: MELO3C011830P1

Description: Similar to Tubulin-specific chaperone E (Pongo abelii) (uniprot_sprot:sp|Q5RBD9|TBCE_PONAB)

Sequence:

>MELO3C011830P1 Similar to Tubulin-specific chaperone E (Pongo abelii) (uniprot_sprot:sp|Q5RBD9|TBCE_PONAB)
MQDSFQPQSEFRLGQRVHFVGDPRRTGTVAFIGTLEGYSGTWVGVDWDDNNGKHDGSINGVRYFQAKSERSGSFVRVQNL
SIGISLLQALDLRYRGDSTKEEEDEMYVLSASDKRVSVQFVGKDLIKDKLSRFEELTSVSLSYMGVSSLGDPGQIGSVLP
NLKQLDLTGNLLSDWKDISTLCDQLQALVAIILSNNLLSCEISGPLQLKHIRILVLNNTGITWMQVEILKHSLPAIEELH
LMGNNISEVKAC*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: alpha-tubulin:GTP + Cofactor E -> alpha-tubulin:GTP:Cofactor E (REACT_17027), Beta-tubulin:GTP:Cofactor D:alpha-tubulin:GTP:Cofactor E+ Cofactor C-> Beta-tubulin:GTP:Cofactor D:alpha-tubulin:GTP:Cofactor E:Cofactor C (REACT_85481), Beta-tubulin:GTP:Cofactor D:alpha-tubulin:GTP:Cofactor E+ Cofactor C-> Beta-tubulin:GTP:Cofactor D:alpha-tubulin:GTP:Cofactor E:Cofactor C (REACT_17016), alpha-tubulin:GTP:Cofactor B +Cofactor E -> alpha-tubulin:GTP: Cofactor E +Cofactor B (REACT_16937), Beta-tubulin:GTP:Cofactor D+alpha-tubulin:GTP:Cofactor E-> Beta-tubulin:GTP:Cofactor D:alpha-tubulin:GTP:Cofactor E (REACT_17060), Beta-tubulin:GTP:Cofactor D:alpha-tubulin:GTP:Cofactor E:Cofactor C-> Beta-tubulin:GDP :alpha-tubulin:GTP heterodimer +Cofactor E+ Cofactor D+ Cofactor C+ Pi (REACT_16958).

biological_process: cellular protein metabolic process, 'de novo' posttranslational protein folding, post-chaperonin tubulin folding pathway.

REACTOME_COMPLEX: beta-tubulin:GTP:Cofactor D:alpha-tubulin:GTP:Cofactor E : Cofactor C [cytosol] (REACT_17144), Cofactor E:GTP-alpha tubulin folding [cytosol] (REACT_17474), beta tubulin:GTP: Cofactor D:alpha tubulin:GTP:Cofactor E [cytosol] (REACT_17650).

REACTOME_PATHWAY: Metabolism of proteins (REACT_86658), Protein folding (REACT_85464), Metabolism of proteins (REACT_17015), Post-chaperonin tubulin folding pathway (REACT_16967), Protein folding (REACT_16952), Post-chaperonin tubulin folding pathway (REACT_108982).

These properties come from phylome analysis


molecular_function: chaperone binding, alpha-tubulin binding, triglyceride lipase activity.

cellular_component: chloroplast, plasma membrane, microtubule, cytoplasm, nucleus.

biological_process: striated muscle myosin thick filament assembly, 'de novo' posttranslational protein folding, embryo development ending in seed dormancy, embryo development ending in birth or egg hatching, determination of adult lifespan, post-chaperonin tubulin folding pathway, protein folding.

These properties come from blast2go analysis


molecular_function: triglyceride lipase activity.

biological_process: multicellular organismal process.

Locations

Located in CM3.5_scaffold00016 from 1166066 to 1175731.

This polypeptide in other databases

In PhylomeDB is Phy003MJ7Z_CUCME .

Related features