Polypeptide MELO3C011981P1
Accession: MELO3C011981P1
Name: MELO3C011981P1
Description: Similar to Signal recognition particle receptor subunit beta (Dictyostelium discoideum) (uniprot_sprot:sp|Q54XX1|SRPRB_DICDI)
Sequence:
>MELO3C011981P1 Similar to Signal recognition particle receptor subunit beta (Dictyostelium discoideum) (uniprot_sprot:sp|Q54XX1|SRPRB_DICDI) MEGTEQWKVQVEQLKVQMEQWLERGLEFVHQIPPIQLYVGVGVLLFTTLLLLLTRLFKRRKSNTIVLSGLSGSGKTILFY QLRDGSSHQGTVTSMEPNEGTFVLHSEIAKKDKLKPVHLVDVPGHSRLRAKLDDFLPQAAGVVFVVDALDFLPNCRAASE YLYDILTNASVVKKKIPVLILCNKTDKVTAHTKEFINRQMEKEIDKLRVSRSAISTADISNDFTLGIPGKAFSFTQCYNK VAVAEASGLTGEVSEVEQFIRENVKF*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: phosphatidylinositol binding, GTP binding, protein binding, signal recognition particle binding, receptor activity.
cellular_component: endoplasmic reticulum.
biological_process: cell communication.
These properties come from reactome analysis
REACTOME_REACTION: Interaction between SRP and SRP Receptor (REACT_99006), Interaction between SRP and SRP Receptor (REACT_83835).
REACTOME_PATHWAY: Insulin Synthesis and Processing (REACT_78124), Diabetes pathways (REACT_106585), Insulin Synthesis and Processing (REACT_98207), Diabetes pathways (REACT_32548).
These properties come from phylome analysis
molecular_function: GTP binding, receptor activity.
These properties come from kegg analysis
KEGG_ORTHOLOGS: signal recognition particle receptor subunit beta (K12272).
This polypeptide in other databases
In PhylomeDB is Phy003A08G_CUCME .

