Polypeptide MELO3C012040P1

Accession: MELO3C012040P1

Name: MELO3C012040P1

Sequence:

>MELO3C012040P1
MKHILLKLADLMNSARNLSNIHADTAPYPLLTLRRLFTVFSLSPKDPSLSQLHVGSFSMFSPSPVFSFYESLKPSVSLSY
SLLRFASSNPSGAEEVAEMFDQTGASAAEVKQAFDVFDVNGDGFIDVEELQRVMCVLRFKEVEGIENCEKMIRKFDCNKD
GRIDLKNLLN*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: ATP Hydrolysis By Myosin (REACT_16995), Release Of ADP From Myosin (REACT_17057), Myosin Binds ATP (REACT_16902), Calcium Binds Troponin-C (REACT_16935).

biological_process: muscle filament sliding.

REACTOME_COMPLEX: Inactive Sarcomere Protein Complex [cytosol] (REACT_17721), Troponin Complex [cytosol] (REACT_17616), Calcium:Troponin Complex [cytosol] (REACT_17267), ADP:Calcium Bound Sarcomere Protein Complex [cytosol] (REACT_17580), Calcium Bound Sarcomere Protein Complex [cytosol] (REACT_17110), ATP:Calcium Bound Sarcomere Protein Complex [cytosol] (REACT_18068), Troponin C:Calcium Complex [cytosol] (REACT_17208), Thin Filament With Troponin Bound Calcium [cytosol] (REACT_17139), Thin Filament [cytosol] (REACT_17696).

REACTOME_PATHWAY: Muscle contraction (REACT_17044), Striated Muscle Contraction (REACT_16969).

These properties come from phylome analysis


molecular_function: calcium ion binding.

These properties come from blast2go analysis


molecular_function: protein binding, calcium ion binding.

cellular_component: cytoplasmic membrane-bounded vesicle.

Locations

Located in CM3.5_scaffold00016 from 2608597 to 2609305.

This polypeptide in other databases

In PhylomeDB is Phy003MB91_CUCME .

Related features