Polypeptide MELO3C012040P1
Accession: MELO3C012040P1
Name: MELO3C012040P1
Sequence:
>MELO3C012040P1 MKHILLKLADLMNSARNLSNIHADTAPYPLLTLRRLFTVFSLSPKDPSLSQLHVGSFSMFSPSPVFSFYESLKPSVSLSY SLLRFASSNPSGAEEVAEMFDQTGASAAEVKQAFDVFDVNGDGFIDVEELQRVMCVLRFKEVEGIENCEKMIRKFDCNKD GRIDLKNLLN*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: ATP Hydrolysis By Myosin (REACT_16995), Release Of ADP From Myosin (REACT_17057), Myosin Binds ATP (REACT_16902), Calcium Binds Troponin-C (REACT_16935).
biological_process: muscle filament sliding.
REACTOME_COMPLEX: Inactive Sarcomere Protein Complex [cytosol] (REACT_17721), Troponin Complex [cytosol] (REACT_17616), Calcium:Troponin Complex [cytosol] (REACT_17267), ADP:Calcium Bound Sarcomere Protein Complex [cytosol] (REACT_17580), Calcium Bound Sarcomere Protein Complex [cytosol] (REACT_17110), ATP:Calcium Bound Sarcomere Protein Complex [cytosol] (REACT_18068), Troponin C:Calcium Complex [cytosol] (REACT_17208), Thin Filament With Troponin Bound Calcium [cytosol] (REACT_17139), Thin Filament [cytosol] (REACT_17696).
REACTOME_PATHWAY: Muscle contraction (REACT_17044), Striated Muscle Contraction (REACT_16969).
These properties come from phylome analysis
molecular_function: calcium ion binding.
These properties come from blast2go analysis
molecular_function: protein binding, calcium ion binding.
cellular_component: cytoplasmic membrane-bounded vesicle.
This polypeptide in other databases
In PhylomeDB is Phy003MB91_CUCME .

