Polypeptide MELO3C012074P3
Accession: MELO3C012074P3
Name: MELO3C012074P3
Description: Similar to Ubiquitin-conjugating enzyme E2 2 (Medicago sativa) (uniprot_sprot:sp|P35130|UBC2_MEDSA)
Sequence:
>MELO3C012074P3 Similar to Ubiquitin-conjugating enzyme E2 2 (Medicago sativa) (uniprot_sprot:sp|P35130|UBC2_MEDSA) MSTPARKRLMRDFRRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFTEDYPNKPPTVRFVSRMFHPN IYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMFSENKREYNRRVREIVEQSWTAD*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: ATP binding, ubiquitin-protein ligase activity.
biological_process: regulation of protein metabolic process, post-translational protein modification, modification-dependent protein catabolic process.
These properties come from reactome analysis
REACTOME_REACTION: Interaction of E3 with substrate and E2-Ub complex (REACT_75856), Transfer of Ub from E2 to substrate and release of E2 (REACT_75901), Transfer of ubiquitin from E1 to E2 (REACT_75860).
biological_process: antigen processing and presentation of peptide antigen via MHC class I, protein polyubiquitination.
REACTOME_COMPLEX: Ubiquitin:E2 conjugating enzymes [cytosol] (REACT_76303), Ag-substrate:E3:E2:Ub [cytosol] (REACT_76727).
REACTOME_PATHWAY: Adaptive Immunity Signaling (REACT_75774), Antigen processing: Ubiquitination & Proteasome degradation (REACT_75842), Immune System (REACT_6900), Class I MHC mediated antigen processing & presentation (REACT_75820).
These properties come from phylome analysis
molecular_function: ubiquitin protein ligase binding, protein domain specific binding, small conjugating protein ligase activity, acid-amino acid ligase activity, protein binding, p53 binding, ATP binding, ubiquitin-protein ligase activity.
cellular_component: cytoplasm, nucleus.
biological_process: negative regulation of induction of apoptosis in response to chemical stimulus, regulation of dipeptide transport, ubiquitin-dependent protein catabolic process via the N-end rule pathway, error-free translesion synthesis, centrosome separation, negative regulation of DNA damage response, signal transduction by p53 class mediator, protein ubiquitination involved in ubiquitin-dependent protein catabolic process, DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis, error-prone translesion synthesis, error-free postreplication DNA repair, meiotic DNA double-strand break formation, growth, positive regulation of proteasomal ubiquitin-dependent protein catabolic process, mitotic cell cycle G1/S transition DNA damage checkpoint, sporulation resulting in formation of a cellular spore, histone monoubiquitination, mitotic spindle organization, transcription from RNA polymerase II promoter, chromatin silencing at telomere, DNA repair, nematode larval development, double-strand break repair via homologous recombination, protein polyubiquitination, reproduction, regulation of protein metabolic process, post-translational protein modification.
These properties come from kegg analysis
COG: Ubiquitin-protein ligase (COG5078).
This polypeptide in other databases
In PhylomeDB is Phy003MAVC_CUCME .

