Polypeptide MELO3C012097P1
Accession: MELO3C012097P1
Name: MELO3C012097P1
Description: Similar to Alpha-1,4-glucan-protein synthase [UDP-forming] (Pisum sativum) (uniprot_sprot:sp|O04300|UPTG_PEA)
Sequence:
>MELO3C012097P1 Similar to Alpha-1,4-glucan-protein synthase [UDP-forming] (Pisum sativum) (uniprot_sprot:sp|O04300|UPTG_PEA) MSHLHIKDNEVDIVIGAFHSDLTSFMNEWRPVFTRYHLIIVKDPELKEDLEIPDGFDLDIYTVQDINRIVGTSNSIKFSG YSCRYFGYLVSRKKYIISVDDDCAPAKDDKGMLIDIVEQHLLNLSTPATPFFFNTLYDPFRKGADFVRGYPFSLRSGVAC SLSCGLWLNLADYDAPTQALKPSLRNTRIVDAVLTIPVGAMLPVSGINIAFDREVVGPALCPALRLAGEGKFRWETMEDI WCGLCVKVTCDHLKLGVKSGQPYVWRNERGNAIESLKKEWEGVKLMEEVVPFFQTLRLPEAAVTAEACFLEIAKAVRDQL GRSNPMFSRVAEAMVEWVEIWKKVGSGPLLGDN*
Download fasta sequence.
Properties
These properties come from kegg analysis
KEGG_REACTION: UDP-L-arabinopyranose (R09009).
These properties come from phylome analysis
molecular_function: protein binding, glycogenin glucosyltransferase activity.
cellular_component: cytosol, cell wall, cell junction, plant-type cell wall, Golgi apparatus.
biological_process: cellulose biosynthetic process, response to salt stress, cellular cell wall organization.
These properties come from blast2go analysis
molecular_function: glycogenin glucosyltransferase activity.
cellular_component: cell junction, plant-type cell wall, Golgi apparatus.
biological_process: cellulose biosynthetic process, response to salt stress, cellular cell wall organization.
This polypeptide in other databases
In PhylomeDB is Phy003A1KT_CUCME .

