Polypeptide MELO3C012141P1
Accession: MELO3C012141P1
Name: MELO3C012141P1
Description: Similar to Putative SNAP25 homologous protein SNAP30 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9LMG8|SNP30_ARATH)
Sequence:
>MELO3C012141P1 Similar to Putative SNAP25 homologous protein SNAP30 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9LMG8|SNP30_ARATH) MFSFMKSPAKVTKQNSVDPELSTGSGTNPFDSDTGPDAKQTLNAARRTSSEPVLPIPNANPFDDDDGFVGRKGTATSSGS KDRYKNDFRDSGGLENQSVQELENYAVYKAEETTKSVNNCLKIAEDIREDATKTLDMLHKQGEQIERTHRMAADMDKDLS KGEKLLNNLGGMFSKPWKPKKTKEITGPLITADHSSGKTENNKKQREKLGLSTGKKQSATKTPPSEPSGAMQKVEVEKEK QDDALSDLSNILGDLKSMAVDMGSELDRQNKALDHLSDDVDELNSRVKGANQRARHLIGK*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: Release of noradrenaline at the synapse (REACT_15448), Serotonin loaded synaptic vesicle docking and priming (REACT_15338), release of L-Glutamate at the synapse (REACT_12411), Vamp7 associated Lysosome to Plasma membrane transport (REACT_14778), Vamp8 associated secretory vesicle to plasma membrane transport (REACT_110416), Vamp8 associated secretory vesicle to plasma membrane transport (REACT_28160), Release of acetylcholine at the synapse (REACT_15404), Release of docked serotonin loaded synaptic vesicle (REACT_15503), Vamp7 associated Lysosome to Plasma membrane transport (REACT_95323), Vamp2 associated secretory vesicle to plasma membrane transport (REACT_14822), Vamp8 associated secretory vesicle to plasma membrane transport (REACT_14821), Release of GABA at the synapse (REACT_23813), Acetylcholine synaptic vesicle docking and priming (REACT_15483), GABA loaded synaptic vesicle Docking and Priming (REACT_23973), BoNT Light Chain Type C1 cleaves SNAP-25 (REACT_11130), Glutamate synaptic vesicle docking and priming (REACT_12617), Release of docked dopamine loaded synaptic vesicle (REACT_15533), Noradrenalin synaptic vesicle docking and priming (REACT_15411), Dopamine synaptic vesicle docking and priming (REACT_15517), BoNT Light Chain Type E cleaves SNAP-25 (REACT_11089), Vamp7 associated Lysosome to Plasma membrane transport (REACT_90536), BoNT Light Chain Type A cleaves SNAP-25 (REACT_11146).
biological_process: post-Golgi vesicle-mediated transport, synaptic transmission, glutamate secretion, cellular membrane organization, neurotransmitter secretion.
REACTOME_COMPLEX: Docked GABA loaded synaptic veiscle [plasma membrane, clathrin sculpted gamma-aminobutyric acid transport vesicle membrane] (REACT_24328), Docked serotonin loaded synaptic vesicle [plasma membrane] (REACT_17565), Docked Glutamate Loaded Synaptic Vesicle [plasma membrane] (REACT_12825), Docked acetylcholine loaded Synaptic Vesicle [plasma membrane] (REACT_17285), Vamp8:SNAP23:Syn4 Secretory granule docking and fusion complex [plasma membrane, secretory granule membrane] (REACT_15240), SNARE complex [plasma membrane, clathrin sculpted glutamate transport vesicle membrane] (REACT_12700), Vamp2:SNAP23:Syn4 Secretory granule docking and fusion complex [plasma membrane, secretory granule membrane] (REACT_15108), Docked Noradrenalin loaded synaptic vesicle [plasma membrane] (REACT_15843), Docked dopamine loaded synaptic vesicle [plasma membrane] (REACT_15684), Vamp7:SNAP23:Syn4 Plasma membrane vesicle docking and fusion complex [plasma membrane, lysosomal membrane] (REACT_14917), SNARE Complex [plasma membrane] (REACT_15643), Core SNARE Complex [plasma membrane, secretory granule membrane] (REACT_16105).
REACTOME_PATHWAY: BoNT Light Chain Types A, C1, E cleave SNAP-25 (REACT_11240), Membrane Trafficking (REACT_83546), Neurotransmitter Release Cycle (REACT_13723), Proteolytic cleavage of SNARE complex proteins (REACT_11242), Serotonin Neurotransmitter Release Cycle (REACT_15425), Glutamate Neurotransmitter Release Cycle (REACT_12591), Transmission across Chemical Synapses (REACT_13477), Dopamine Neurotransmitter Release Cycle (REACT_15293), trans-Golgi Network Vesicle Budding (REACT_31975), Clathrin derived vesicle budding (REACT_19187), Synaptic Transmission (REACT_13685), Acetylcholine Neurotransmitter Release Cycle (REACT_15309), Membrane Trafficking (REACT_11123), Clathrin derived vesicle budding (REACT_100038), trans-Golgi Network Vesicle Budding (REACT_11235), Norepinephrine Neurotransmitter Release Cycle (REACT_15418), Botulinum neurotoxicity (REACT_11184), Clathrin derived vesicle budding (REACT_101182), trans-Golgi Network Vesicle Budding (REACT_31900), Membrane Trafficking (REACT_86557), GABA synthesis, release, reuptake and degradation (REACT_23947).
These properties come from phylome analysis
cellular_component: membrane, cytoplasm.
biological_process: vesicle-mediated transport, protein transport, cellular membrane fusion.
These properties come from blast2go analysis
cellular_component: plasma membrane.
This polypeptide in other databases
In PhylomeDB is Phy003LHSA_CUCME .

