Polypeptide MELO3C012198P1
Accession: MELO3C012198P1
Name: MELO3C012198P1
Description: Similar to Predicted protein (Populus trichocarpa) (uniref90:UniRef90_B9HWP4)
Sequence:
>MELO3C012198P1 Similar to Predicted protein (Populus trichocarpa) (uniref90:UniRef90_B9HWP4) MAAAKTVIFSSPTLLHHCFNPSQTPPHPSINSFKPILSSKANPSNGVFIRSRNFCTAPVTRGRRYKVLTVSSLVDGYTGD DDESSQRNSDTGAAIDIKLPRRSLMVTFTCNQCSERTKRLINRLAYERGLVFVQCAGCQKYHKLVDNLGLIVEYDFREED TDLDSNSDQV*
Download fasta sequence.
Properties
These properties come from blast2go analysis
cellular_component: plastid.
These properties come from phylome analysis
molecular_function: metal ion binding, protein binding.
cellular_component: mitochondrial matrix, mitochondrial inner membrane.
biological_process: protein stabilization, protein import into mitochondrial matrix, response to unfolded protein, protein folding.
This polypeptide in other databases
In PhylomeDB is Phy003A3GY_CUCME .

