Polypeptide MELO3C012457P3

Accession: MELO3C012457P3

Name: MELO3C012457P3

Description: Similar to Annexin-like protein RJ4 (Fragaria ananassa PE=2 SV=2) (uniprot_sprot:sp|P51074|ANX4_FRAAN)

Sequence:

>MELO3C012457P3 Similar to Annexin-like protein RJ4 (Fragaria ananassa PE=2 SV=2) (uniprot_sprot:sp|P51074|ANX4_FRAAN)
MATLLVPHDVPPPNVDAEAIKAAFRGWGTDEKAIVAVLGYRNAPQRRQIRIAYEQLFEEDLVKRFESELSGHLERAVYRW
ILDPEDRDAVLAHVALRKPNEDFAVLVEFSCIYSPEEFLAVRRAYQHRYKRSLEEDVAANTHDDFRKLLVGLVSAYRYNG
GEIDARLAKSEAEILERAVKDKAFNHEDVIRILTTRSKAQLIATFNHYKDANGISISKQLGQDRAANEFTEALKTVIRCI
NDPVKYYEKVVRNAIKKVGKSDEDALTRVVVTRAEKDLRQIKEAYHKRNSVTLDDAVKKETSGDYKHFILALLGNQTE*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: Liganded Gi-activating GPCRs bind inactive heterotrimeric G-protein Gi (REACT_22289), The Ligand:GPCR:Gq complex dissociates (REACT_22263), Liganded Gq-activating GPCRs bind inactive heterotrimeric Gq (REACT_22436), Liganded Gq/11-activating GPCRs act as GEFs for Gq/11 (REACT_15291), FPRL2 receptor binds a wide range of ligands (REACT_21406), The Ligand:GPCR:Gi complex dissociates (REACT_22239), FPRL1 receptor binds a wide range of ligands (REACT_18373), Liganded Gi-activating GPCR acts as a GEF for Gi (REACT_15538).

REACTOME_COMPLEX: FPRL1:FPRL1 ligands [plasma membrane] (REACT_18658), Ligand:GPCR complexes that activate Gi:Heterotrimeric G-protein Gi (active) [plasma membrane] (REACT_23190), Ligand:GPCR complexes that activate Gi:Heterotrimeric G-protein Gi (inactive) [plasma membrane] (REACT_22813), Ligand:GPCR complexes that activate Gq/11:Heterotrimeric G-protein Gq (inactive) [plasma membrane] (REACT_22865), FPRL2:FPRL2 ligands [plasma membrane] (REACT_21978), Ligand:GPCR complexes that activate Gq/11:Heterotrimeric G-protein Gq (active) [plasma membrane] (REACT_22589).

REACTOME_PATHWAY: Formyl peptide receptors bind formyl peptides and many other ligands (REACT_21264), Class A/1 (Rhodopsin-like receptors) (REACT_14828), GPCR ligand binding (REACT_21340), Peptide ligand-binding receptors (REACT_14819), Signaling by GPCR (REACT_14797), G alpha (i) signalling events (REACT_19231), GPCR downstream signaling (REACT_19184), G alpha (q) signalling events (REACT_18283).

These properties come from phylome analysis


molecular_function: calcium-dependent phospholipid binding, calcium ion binding.

These properties come from blast2go analysis


molecular_function: calcium-dependent phospholipid binding, calcium ion binding.

Locations

Located in CM3.5_scaffold00016 from 5315322 to 5317531.

This polypeptide in other databases

In PhylomeDB is Phy003A5G8_CUCME .

Related features