Polypeptide MELO3C012489P1

Accession: MELO3C012489P1

Name: MELO3C012489P1

Description: Similar to Peptidyl-prolyl cis-trans isomerase H (Homo sapiens) (uniprot_sprot:sp|O43447|PPIH_HUMAN)

Sequence:

>MELO3C012489P1 Similar to Peptidyl-prolyl cis-trans isomerase H (Homo sapiens) (uniprot_sprot:sp|O43447|PPIH_HUMAN)
MASVGGTASGGVEWHVRPPNPKNPIVFFDVTIGTIPAGRIKMELFADIAPKTAENFRQFCTGEYRKAGLPVGYKGCQFHR
VIKDFMIQAGDFVKGDGSGCVSIYGHKFEDENFVAKHTGPGLLSMANSGPGTNGCQFFITCAKCDWLDNKHVVFGRVLGD
GLLVVRKIENVATGPNNRPKLACVIAECGEM*

Download fasta sequence.

Properties

These properties come from kegg analysis


KEGG_ORTHOLOGS: peptidyl-prolyl isomerase H (cyclophilin H) [EC:5.2.1.8] (K09567).

molecular_function: cyclosporin A binding, peptidyl-prolyl cis-trans isomerase activity.

These properties come from phylome analysis


molecular_function: ribonucleoprotein binding, cyclosporin A binding, protein binding, peptidyl-prolyl cis-trans isomerase activity.

cellular_component: precatalytic spliceosome, U4/U6 snRNP, U4/U6 x U5 tri-snRNP complex, nuclear speck, plasma membrane, vacuole, cytoplasm.

biological_process: protein complex assembly, nuclear mRNA splicing, via spliceosome, protein folding.

These properties come from blast2go analysis


molecular_function: peptidyl-prolyl cis-trans isomerase activity.

biological_process: protein folding.

Locations

Located in CM3.5_scaffold00016 from 5531767 to 5543378.

This polypeptide in other databases

In PhylomeDB is Phy003ABQE_CUCME .

Related features