Polypeptide MELO3C012492P1
Accession: MELO3C012492P1
Name: MELO3C012492P1
Description: Similar to Retinoblastoma-related protein (Ricinus communis) (uniprot_sprot:sp|B9SVG9|RBR_RICCO)
Sequence:
>MELO3C012492P1 Similar to Retinoblastoma-related protein (Ricinus communis) (uniprot_sprot:sp|B9SVG9|RBR_RICCO) MENVGETKPSATSSCHTDGGTDTAADLQFSVLCQHGLHLDDNCCNQAFKLFRETKHLLVANISAIGSGIPEEAERFWSAF VLYSVKRLRDKNPESSHQGSENNSFTLCHILRVCKLNIVEFFKELPQFVVKAGPVLSNLYGADWENRLEAKELQANFVHL TLLSKYYKRVYREFFSTNDANVEKKSAISCPTGYLSDYHRFGWLLFLALRVHAFSRFKDLVTCTNGLVSILAILILHVPV HFRNFNIIDSERLVKKGGKGVDLLGSLCDVYDTSEEELREVMEKANSLIEDILKKKPRLASECNSKSLENIDTEGLIYFE GLMEEPSLSVSLEILEKDYEDAIHNKGEQLDERVFVNDEDSLLGSGSLSAGAVTMGGIKRKLDSMCSPARTITSPMSPLR SPASHVNGTLNSGSAKIAATPVSTAMTTAKWLRTVISPLPAKPSVEMERFLTSCDRDVTNDVVRRAHIILEAIFPNTALG ERCIAGNLQSASLMDNIWAEQRRLEALKLYYRVLEAMCRAESQMLHVTNLTSLLTNERFHRCMLACSAELVLATHKTVTM LFPAVLERTGITAFDLSKVIESFIRHEESLPRELRRHLNSLEERLLESMVWEKGSSIYNSLIVAKPGLGAEINRLGLLAE PMPSLDAIAVQINFSGIGVSATPNLQKHESLPGQNGDIRSPKRLCTDLRSVLVERNSFTSPVKDRLMAFSSIKSKLLPPP LQSAFASPTRPNPGGGGETCAETGINIFFSKITKLAAVRVNGMVERLQLSHQIRENVYCLFQQILSQKTSILFNRHIDQI ILCCFYGVAKISQLSLTFREIIYNYRKQPQCKPQVFRNVFVDWSSARRNGRSGQDHVDIITFYNEIFIPSVKPLLVEIGP AGSTMKTDRVPQVNNDSDAPCPGSPKLSPFPSLPDMSPKKVSSAHNVYVSPLRSSKMDALISHSSKSYYACVGESTHAFQ SPSKDLTAINNRLNGTRKLRGTLNFDDADVGLVSDSLVANSLYLQNGSCGSSSGAPLKSEQPES*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: Pp2a mediated localization of Rb protein in chromatin (REACT_421), Cyclin E:Cdk2-mediated phosphorylation of Rb (REACT_8993), Replication initiation regulation by E2F1/Rbf1 (REACT_1967), Replication initiation regulation by Rb1/E2F1 (REACT_1277), Orc1 is phosphorylated by cyclin A/CDK2 (REACT_2111), Pp2a mediated localization of Rb protein in chromatin (REACT_28065), Phosphorylation of proteins involved in the G1/S transition by Cyclin A:Cdk2 (REACT_9007), Pp2a mediated localization of Rb protein in chromatin (REACT_96431), Association of Rb with Cyclin E:Cdk2 complexes (REACT_9050), Cyclin D:Cdk4/6 mediated phosphorylation of Rb and dissociation of phospho-Rb from the E2F1/2/3:DP-1 complexes (REACT_1882).
biological_process: mitotic cell cycle, G1 phase of mitotic cell cycle, S phase of mitotic cell cycle, G1/S transition of mitotic cell cycle.
REACTOME_COMPLEX: Rb-E2F1/2/3:DP-1 complex [nucleoplasm] (REACT_4483), Cyclin A:Cdk2:phosphorylated substrate complex [nucleoplasm] (REACT_9299), Cyclin E:Phospho-Cdk2(Thr160):Rb complex [nucleoplasm] (REACT_9136), Aborted replication complex [nucleoplasm] (REACT_2817), Cyclin A:Cdk2:substrate complex [nucleoplasm] (REACT_9192), Cyclin E:phospho-Cdk2 (Thr 160):phospho-Rb [nucleoplasm] (REACT_9190), Rb1:RNA primer-DNA primer:origin duplex with DNA damage [nucleoplasm] (REACT_3869), Aborted replication complex [nucleoplasm] (REACT_4193).
REACTOME_PATHWAY: E2F mediated regulation of DNA replication (REACT_81617), Switching of origins to a post-replicative state (REACT_2148), DNA Replication (REACT_383), Cell Cycle, Mitotic (REACT_96281), Orc1 removal from chromatin (REACT_1156), Inhibition of replication initiation of damaged DNA by Rb/E2F1 (REACT_329), Cell Cycle, Mitotic (REACT_152), G1/S Transition (REACT_1783), Removal of licensing factors from origins (REACT_207), Phosphorylation of proteins involved in G1/S transition by active Cyclin E:Cdk2 complexes (REACT_308), Cyclin E associated events during G1/S transition (REACT_1574), Cyclin A:Cdk2-associated events at S phase entry (REACT_9029), Cell Cycle, Mitotic (REACT_85950), Inhibition of replication initiation of damaged DNA by Rb/E2F1 (REACT_100648), Regulation of DNA replication (REACT_829), E2F mediated regulation of DNA replication (REACT_79760), G1 Phase (REACT_1590), Cyclin D associated events in G1 (REACT_821), Synthesis of DNA (REACT_2014), Mitotic G1-G1/S phases (REACT_82281), G1/S Transition (REACT_87037), Mitotic G1-G1/S phases (REACT_109527), Mitotic G1-G1/S phases (REACT_93079), Mitotic G1-G1/S phases (REACT_21267), Inhibition of replication initiation of damaged DNA by Rb/E2F1 (REACT_106235), G1/S Transition (REACT_109784), Inhibition of replication initiation of damaged DNA by Rb/E2F1 (REACT_84947), E2F mediated regulation of DNA replication (REACT_96254), S Phase (REACT_899), Cell Cycle, Mitotic (REACT_90846), E2F mediated regulation of DNA replication (REACT_471), G1/S Transition (REACT_102687).
These properties come from phylome analysis
molecular_function: transcription factor binding.
cellular_component: cytosol, nucleus.
biological_process: regulation of stem cell maintenance, regulation of nuclear division, regulation of cell cycle, leaf development, interspecies interaction between organisms, generative cell differentiation, trichome morphogenesis, double fertilization forming a zygote and endosperm, embryo sac development, cell cycle, transcription, DNA-dependent, regulation of gene expression by genetic imprinting, cell fate specification, regulation of cell growth, G1/S transition of mitotic cell cycle, regulation of DNA endoreduplication, regulation of transcription, DNA-dependent.
These properties come from blast2go analysis
cellular_component: nucleus.
biological_process: negative regulation of cell division, regulation of DNA endoreduplication, regulation of transcription, DNA-dependent.
This polypeptide in other databases
In PhylomeDB is Phy003A11R_CUCME .
